Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | I6H62_RS01385 | Genome accession | NZ_CP065981 |
| Coordinates | 278130..278612 (+) | Length | 160 a.a. |
| NCBI ID | WP_198479451.1 | Uniprot ID | - |
| Organism | Macrococcoides caseolyticum strain FDAARGOS_1005 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 271058..308648 | 278130..278612 | within | 0 |
Gene organization within MGE regions
Location: 271058..308648
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6H62_RS01320 (I6H62_01320) | - | 271058..272224 (-) | 1167 | WP_198479441.1 | tyrosine-type recombinase/integrase | - |
| I6H62_RS01325 (I6H62_01325) | - | 272294..272923 (-) | 630 | WP_232618434.1 | DUF4352 domain-containing protein | - |
| I6H62_RS01330 (I6H62_01330) | - | 272983..273468 (-) | 486 | WP_198479443.1 | hypothetical protein | - |
| I6H62_RS01335 (I6H62_01335) | - | 273481..273819 (-) | 339 | WP_198479444.1 | helix-turn-helix domain-containing protein | - |
| I6H62_RS01340 (I6H62_01340) | - | 273972..274181 (+) | 210 | WP_101143656.1 | helix-turn-helix domain-containing protein | - |
| I6H62_RS01345 (I6H62_01345) | - | 274231..274500 (+) | 270 | WP_198479590.1 | hypothetical protein | - |
| I6H62_RS01350 (I6H62_01350) | - | 274497..274685 (+) | 189 | WP_198479445.1 | hypothetical protein | - |
| I6H62_RS01355 (I6H62_01355) | - | 274778..275530 (+) | 753 | WP_162485202.1 | BRO family protein | - |
| I6H62_RS01360 (I6H62_01360) | - | 275520..275780 (+) | 261 | WP_198479446.1 | hypothetical protein | - |
| I6H62_RS01365 (I6H62_01365) | - | 275773..276759 (+) | 987 | WP_198479447.1 | DnaD domain-containing protein | - |
| I6H62_RS01370 (I6H62_01370) | - | 276740..277054 (+) | 315 | WP_198479448.1 | hypothetical protein | - |
| I6H62_RS01375 (I6H62_01375) | - | 277180..277653 (-) | 474 | WP_198479449.1 | DUF2321 domain-containing protein | - |
| I6H62_RS01380 (I6H62_01380) | - | 277748..278140 (+) | 393 | WP_198479450.1 | hypothetical protein | - |
| I6H62_RS01385 (I6H62_01385) | ssbA | 278130..278612 (+) | 483 | WP_198479451.1 | single-stranded DNA-binding protein | Machinery gene |
| I6H62_RS01390 (I6H62_01390) | - | 278626..278967 (+) | 342 | WP_101142790.1 | hypothetical protein | - |
| I6H62_RS01395 (I6H62_01395) | - | 278978..279226 (+) | 249 | WP_101035836.1 | hypothetical protein | - |
| I6H62_RS01400 (I6H62_01400) | - | 279239..279481 (+) | 243 | WP_198479452.1 | hypothetical protein | - |
| I6H62_RS01405 (I6H62_01405) | - | 279495..279956 (+) | 462 | WP_198479453.1 | MazG-like family protein | - |
| I6H62_RS01410 (I6H62_01410) | - | 279985..280122 (+) | 138 | WP_198479454.1 | hypothetical protein | - |
| I6H62_RS01415 (I6H62_01415) | - | 280223..280735 (+) | 513 | WP_198479455.1 | Holliday junction resolvase RecU | - |
| I6H62_RS01420 (I6H62_01420) | - | 280746..280898 (+) | 153 | WP_198479456.1 | hypothetical protein | - |
| I6H62_RS01425 (I6H62_01425) | - | 280910..281305 (+) | 396 | WP_198479457.1 | YopX family protein | - |
| I6H62_RS01430 (I6H62_01430) | - | 281424..281873 (+) | 450 | WP_198479458.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| I6H62_RS01435 (I6H62_01435) | - | 281873..282421 (+) | 549 | WP_198479459.1 | tyrosine-type recombinase/integrase | - |
| I6H62_RS01440 (I6H62_01440) | - | 282496..283251 (+) | 756 | WP_198479460.1 | hypothetical protein | - |
| I6H62_RS01445 (I6H62_01445) | - | 283398..284117 (+) | 720 | WP_198479461.1 | hypothetical protein | - |
| I6H62_RS01450 (I6H62_01450) | - | 284298..284645 (+) | 348 | WP_198479572.1 | HNH endonuclease | - |
| I6H62_RS01455 (I6H62_01455) | - | 284749..285261 (+) | 513 | WP_198479462.1 | phage terminase small subunit P27 family | - |
| I6H62_RS01460 (I6H62_01460) | - | 285258..286964 (+) | 1707 | WP_086038617.1 | terminase large subunit | - |
| I6H62_RS01465 (I6H62_01465) | - | 287138..288379 (+) | 1242 | WP_198479463.1 | phage portal protein | - |
| I6H62_RS01470 (I6H62_01470) | - | 288363..288932 (+) | 570 | WP_041636125.1 | HK97 family phage prohead protease | - |
| I6H62_RS01475 (I6H62_01475) | - | 288942..290075 (+) | 1134 | WP_198479464.1 | phage major capsid protein | - |
| I6H62_RS01480 (I6H62_01480) | - | 290090..290296 (+) | 207 | WP_198479465.1 | hypothetical protein | - |
| I6H62_RS01485 (I6H62_01485) | - | 290277..290612 (+) | 336 | WP_198479466.1 | head-tail connector protein | - |
| I6H62_RS01490 (I6H62_01490) | - | 290581..290904 (+) | 324 | WP_198479467.1 | head-tail adaptor protein | - |
| I6H62_RS01495 (I6H62_01495) | - | 290901..291293 (+) | 393 | WP_012657426.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| I6H62_RS01500 (I6H62_01500) | - | 291290..291679 (+) | 390 | WP_198479468.1 | hypothetical protein | - |
| I6H62_RS01505 (I6H62_01505) | - | 291692..292279 (+) | 588 | WP_012657424.1 | major tail protein | - |
| I6H62_RS01510 (I6H62_01510) | gpG | 292345..292698 (+) | 354 | WP_133421829.1 | phage tail assembly chaperone G | - |
| I6H62_RS01515 (I6H62_01515) | - | 292758..292907 (+) | 150 | WP_157827311.1 | hypothetical protein | - |
| I6H62_RS01520 (I6H62_01520) | - | 292932..297293 (+) | 4362 | WP_198479469.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| I6H62_RS01525 (I6H62_01525) | - | 297303..298823 (+) | 1521 | WP_198479470.1 | phage distal tail protein | - |
| I6H62_RS01530 (I6H62_01530) | - | 298839..302183 (+) | 3345 | WP_198479471.1 | phage tail spike protein | - |
| I6H62_RS01535 (I6H62_01535) | - | 302185..302583 (+) | 399 | WP_086038625.1 | hypothetical protein | - |
| I6H62_RS01540 (I6H62_01540) | - | 302567..302737 (+) | 171 | WP_157820106.1 | hypothetical protein | - |
| I6H62_RS01545 (I6H62_01545) | - | 302782..303069 (+) | 288 | WP_198479472.1 | hypothetical protein | - |
| I6H62_RS01550 (I6H62_01550) | - | 303084..303596 (+) | 513 | WP_198479473.1 | holin family protein | - |
| I6H62_RS01555 (I6H62_01555) | - | 303651..304559 (+) | 909 | WP_198479474.1 | N-acetylmuramoyl-L-alanine amidase | - |
| I6H62_RS01560 (I6H62_01560) | - | 305316..305705 (-) | 390 | WP_101142040.1 | hypothetical protein | - |
| I6H62_RS01565 (I6H62_01565) | - | 305973..306476 (+) | 504 | WP_086038633.1 | hypothetical protein | - |
| I6H62_RS01570 (I6H62_01570) | - | 306578..306928 (+) | 351 | WP_133453395.1 | hypothetical protein | - |
| I6H62_RS01575 (I6H62_01575) | - | 306925..307089 (-) | 165 | WP_146034097.1 | transposase family protein | - |
| I6H62_RS01580 (I6H62_01580) | - | 308127..308333 (+) | 207 | WP_101040651.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 160 a.a. Molecular weight: 18020.95 Da Isoelectric Point: 5.0189
>NTDB_id=515887 I6H62_RS01385 WP_198479451.1 278130..278612(+) (ssbA) [Macrococcoides caseolyticum strain FDAARGOS_1005]
MINRVVLVGRLTKDPEYRVTPSGVAIASFTLAVNRTFTNAQGERQADFINCIVFRKQADNVNTYLHKGSLAGVDGRLQSR
SYENQEGRRVFVTEVVCESVQFLEPKNSRNGADHYDDYPQAQKTNDYAEREKKAQETMPANNPFANTDGPLEISDDDLPF
MINRVVLVGRLTKDPEYRVTPSGVAIASFTLAVNRTFTNAQGERQADFINCIVFRKQADNVNTYLHKGSLAGVDGRLQSR
SYENQEGRRVFVTEVVCESVQFLEPKNSRNGADHYDDYPQAQKTNDYAEREKKAQETMPANNPFANTDGPLEISDDDLPF
Nucleotide
Download Length: 483 bp
>NTDB_id=515887 I6H62_RS01385 WP_198479451.1 278130..278612(+) (ssbA) [Macrococcoides caseolyticum strain FDAARGOS_1005]
ATGATAAATAGAGTAGTCCTAGTAGGACGTTTAACAAAGGATCCTGAATACCGAGTAACGCCATCAGGTGTTGCAATAGC
ATCATTCACATTAGCAGTTAATCGTACATTCACTAATGCACAAGGCGAGCGACAAGCAGACTTTATAAACTGTATCGTAT
TTCGTAAGCAAGCAGACAATGTTAATACTTACTTGCATAAAGGAAGTTTAGCTGGAGTCGATGGAAGATTACAATCACGT
AGCTATGAGAATCAAGAAGGCAGACGAGTATTCGTAACTGAGGTTGTATGTGAGTCAGTTCAATTCCTAGAACCGAAGAA
TTCAAGAAATGGTGCAGATCACTATGATGATTATCCGCAAGCACAAAAAACAAATGATTATGCAGAACGAGAGAAAAAGG
CACAGGAGACAATGCCTGCTAATAATCCCTTTGCTAATACCGATGGGCCATTAGAAATTAGCGATGACGATTTACCGTTT
TAA
ATGATAAATAGAGTAGTCCTAGTAGGACGTTTAACAAAGGATCCTGAATACCGAGTAACGCCATCAGGTGTTGCAATAGC
ATCATTCACATTAGCAGTTAATCGTACATTCACTAATGCACAAGGCGAGCGACAAGCAGACTTTATAAACTGTATCGTAT
TTCGTAAGCAAGCAGACAATGTTAATACTTACTTGCATAAAGGAAGTTTAGCTGGAGTCGATGGAAGATTACAATCACGT
AGCTATGAGAATCAAGAAGGCAGACGAGTATTCGTAACTGAGGTTGTATGTGAGTCAGTTCAATTCCTAGAACCGAAGAA
TTCAAGAAATGGTGCAGATCACTATGATGATTATCCGCAAGCACAAAAAACAAATGATTATGCAGAACGAGAGAAAAAGG
CACAGGAGACAATGCCTGCTAATAATCCCTTTGCTAATACCGATGGGCCATTAGAAATTAGCGATGACGATTTACCGTTT
TAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.558 |
100 |
0.619 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.531 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.637 |
70.625 |
0.4 |