Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | JC281_RS06070 | Genome accession | NZ_CP065920 |
| Coordinates | 1288271..1288732 (+) | Length | 153 a.a. |
| NCBI ID | WP_100006931.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain SP_11306-1A | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1281123..1324784 | 1288271..1288732 | within | 0 |
Gene organization within MGE regions
Location: 1281123..1324784
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JC281_RS06010 (JC281_06010) | - | 1281123..1282346 (-) | 1224 | WP_037542866.1 | tyrosine-type recombinase/integrase | - |
| JC281_RS06015 (JC281_06015) | - | 1282407..1283018 (-) | 612 | WP_100006941.1 | hypothetical protein | - |
| JC281_RS06020 (JC281_06020) | - | 1283065..1283526 (-) | 462 | WP_100006940.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JC281_RS06025 (JC281_06025) | - | 1283540..1283854 (-) | 315 | WP_096665808.1 | helix-turn-helix domain-containing protein | - |
| JC281_RS06030 (JC281_06030) | - | 1284031..1284258 (+) | 228 | WP_100006939.1 | BetR domain protein | - |
| JC281_RS06035 (JC281_06035) | - | 1284455..1284718 (+) | 264 | WP_100006938.1 | helix-turn-helix domain-containing protein | - |
| JC281_RS06040 (JC281_06040) | - | 1284733..1284909 (+) | 177 | WP_180291842.1 | hypothetical protein | - |
| JC281_RS06045 (JC281_06045) | - | 1284911..1285210 (+) | 300 | WP_100006937.1 | DUF2482 family protein | - |
| JC281_RS06050 (JC281_06050) | - | 1285314..1286453 (+) | 1140 | WP_198456197.1 | hypothetical protein | - |
| JC281_RS12655 (JC281_06055) | - | 1286446..1286643 (+) | 198 | WP_198456198.1 | helix-turn-helix domain-containing protein | - |
| JC281_RS06060 (JC281_06060) | - | 1286657..1287571 (+) | 915 | WP_100006933.1 | recombinase RecT | - |
| JC281_RS06065 (JC281_06065) | - | 1287634..1288269 (+) | 636 | WP_100006932.1 | MBL fold metallo-hydrolase | - |
| JC281_RS06070 (JC281_06070) | ssb | 1288271..1288732 (+) | 462 | WP_100006931.1 | single-stranded DNA-binding protein | Machinery gene |
| JC281_RS06075 (JC281_06075) | - | 1288747..1289154 (+) | 408 | WP_198456199.1 | hypothetical protein | - |
| JC281_RS06080 (JC281_06080) | - | 1289170..1289889 (+) | 720 | WP_198456200.1 | hypothetical protein | - |
| JC281_RS06085 (JC281_06085) | - | 1289941..1290705 (+) | 765 | WP_198456201.1 | DnaD domain-containing protein | - |
| JC281_RS06090 (JC281_06090) | - | 1290720..1291502 (+) | 783 | WP_096636858.1 | ATP-binding protein | - |
| JC281_RS06095 (JC281_06095) | - | 1292019..1292264 (+) | 246 | WP_198456202.1 | hypothetical protein | - |
| JC281_RS06100 (JC281_06100) | - | 1292269..1292568 (+) | 300 | WP_100006924.1 | hypothetical protein | - |
| JC281_RS06105 (JC281_06105) | - | 1292571..1292798 (+) | 228 | WP_198456214.1 | SAV1978 family virulence-associated passenger protein | - |
| JC281_RS06110 (JC281_06110) | - | 1292801..1292986 (+) | 186 | WP_198456203.1 | hypothetical protein | - |
| JC281_RS06115 (JC281_06115) | - | 1292983..1293333 (+) | 351 | WP_198456204.1 | YopX family protein | - |
| JC281_RS06120 (JC281_06120) | - | 1293333..1293548 (+) | 216 | WP_160215698.1 | hypothetical protein | - |
| JC281_RS06125 (JC281_06125) | - | 1293545..1293940 (+) | 396 | WP_110148353.1 | hypothetical protein | - |
| JC281_RS06130 (JC281_06130) | - | 1293937..1294299 (+) | 363 | WP_015729203.1 | hypothetical protein | - |
| JC281_RS06135 (JC281_06135) | - | 1294300..1294620 (+) | 321 | WP_198456226.1 | hypothetical protein | - |
| JC281_RS06140 (JC281_06140) | - | 1294622..1295155 (+) | 534 | WP_242062921.1 | MazG-like family protein | - |
| JC281_RS06145 (JC281_06145) | - | 1295176..1295619 (+) | 444 | WP_037542895.1 | hypothetical protein | - |
| JC281_RS06150 (JC281_06150) | - | 1295744..1296157 (+) | 414 | WP_103866780.1 | sigma-70 family RNA polymerase sigma factor | - |
| JC281_RS06155 (JC281_06155) | - | 1296441..1296776 (+) | 336 | WP_015729199.1 | HNH endonuclease | - |
| JC281_RS06160 (JC281_06160) | - | 1296913..1297212 (+) | 300 | WP_103866782.1 | P27 family phage terminase small subunit | - |
| JC281_RS06165 (JC281_06165) | - | 1297209..1298849 (+) | 1641 | WP_103866784.1 | terminase TerL endonuclease subunit | - |
| JC281_RS06170 (JC281_06170) | - | 1298864..1300018 (+) | 1155 | WP_198456206.1 | phage portal protein | - |
| JC281_RS06175 (JC281_06175) | - | 1300008..1300730 (+) | 723 | WP_103866788.1 | head maturation protease, ClpP-related | - |
| JC281_RS06180 (JC281_06180) | - | 1300759..1301886 (+) | 1128 | WP_198456207.1 | phage major capsid protein | - |
| JC281_RS06185 (JC281_06185) | - | 1301955..1302251 (+) | 297 | WP_198456208.1 | phage gp6-like head-tail connector protein | - |
| JC281_RS06190 (JC281_06190) | - | 1302232..1302594 (+) | 363 | WP_037542906.1 | hypothetical protein | - |
| JC281_RS06195 (JC281_06195) | - | 1302591..1302992 (+) | 402 | WP_037542908.1 | hypothetical protein | - |
| JC281_RS06200 (JC281_06200) | - | 1302994..1303389 (+) | 396 | WP_037542910.1 | hypothetical protein | - |
| JC281_RS06205 (JC281_06205) | - | 1303429..1304109 (+) | 681 | WP_037542920.1 | major tail protein | - |
| JC281_RS06210 (JC281_06210) | - | 1304204..1304665 (+) | 462 | WP_015729188.1 | Ig-like domain-containing protein | - |
| JC281_RS06215 (JC281_06215) | gpG | 1304773..1305123 (+) | 351 | WP_100006915.1 | phage tail assembly chaperone G | - |
| JC281_RS06220 (JC281_06220) | - | 1305165..1305320 (+) | 156 | WP_015729186.1 | hypothetical protein | - |
| JC281_RS06225 (JC281_06225) | - | 1305334..1310919 (+) | 5586 | WP_198455972.1 | phage tail tape measure protein | - |
| JC281_RS06230 (JC281_06230) | - | 1310922..1311746 (+) | 825 | WP_015729184.1 | phage tail domain-containing protein | - |
| JC281_RS06235 (JC281_06235) | - | 1311747..1313321 (+) | 1575 | WP_242062902.1 | prophage endopeptidase tail family protein | - |
| JC281_RS06240 (JC281_06240) | - | 1313308..1313508 (+) | 201 | WP_015729182.1 | hypothetical protein | - |
| JC281_RS06245 (JC281_06245) | - | 1313515..1314135 (+) | 621 | WP_015729181.1 | hypothetical protein | - |
| JC281_RS06250 (JC281_06250) | - | 1314147..1315178 (+) | 1032 | WP_198455974.1 | SGNH/GDSL hydrolase family protein | - |
| JC281_RS06255 (JC281_06255) | - | 1315195..1316466 (+) | 1272 | WP_198455977.1 | phage baseplate upper protein | - |
| JC281_RS06260 (JC281_06260) | - | 1316537..1318537 (+) | 2001 | WP_198455984.1 | BppU family phage baseplate upper protein | - |
| JC281_RS06265 (JC281_06265) | - | 1318549..1318980 (+) | 432 | WP_198455986.1 | phage holin family protein | - |
| JC281_RS06270 (JC281_06270) | - | 1318993..1319940 (+) | 948 | WP_198455988.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| JC281_RS06275 (JC281_06275) | - | 1320145..1320492 (-) | 348 | WP_015729174.1 | hypothetical protein | - |
| JC281_RS06280 (JC281_06280) | - | 1320489..1320641 (-) | 153 | WP_015729173.1 | ribbon-helix-helix domain-containing protein | - |
| JC281_RS06285 (JC281_06285) | - | 1320770..1321432 (+) | 663 | WP_198455990.1 | hypothetical protein | - |
| JC281_RS06290 (JC281_06290) | - | 1321422..1321784 (+) | 363 | WP_198455992.1 | hypothetical protein | - |
| JC281_RS06295 (JC281_06295) | - | 1321844..1322995 (+) | 1152 | WP_015729170.1 | SNF2-related protein | - |
| JC281_RS06300 (JC281_06300) | - | 1322995..1324284 (+) | 1290 | WP_198455994.1 | DUF3440 domain-containing protein | - |
| JC281_RS06305 (JC281_06305) | - | 1324281..1324784 (+) | 504 | WP_238402335.1 | IbrB-like domain-containing protein | - |
Sequence
Protein
Download Length: 153 a.a. Molecular weight: 16791.61 Da Isoelectric Point: 7.8486
>NTDB_id=515193 JC281_RS06070 WP_100006931.1 1288271..1288732(+) (ssb) [Staphylococcus pseudintermedius strain SP_11306-1A]
MINRVVLVGRLTKNPDLRHTPNGISVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRIKSR
SYENKDGQRVYVTEVICDSVQFLESKSTNSNQSQGGIASGQYQPKTNHVAATSQNPFVNTNDSIDISDDDLPF
MINRVVLVGRLTKNPDLRHTPNGISVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRIKSR
SYENKDGQRVYVTEVICDSVQFLESKSTNSNQSQGGIASGQYQPKTNHVAATSQNPFVNTNDSIDISDDDLPF
Nucleotide
Download Length: 462 bp
>NTDB_id=515193 JC281_RS06070 WP_100006931.1 1288271..1288732(+) (ssb) [Staphylococcus pseudintermedius strain SP_11306-1A]
ATGATTAATAGAGTTGTACTTGTAGGAAGATTAACTAAAAATCCTGATTTAAGACATACACCAAACGGAATAAGTGTTAG
CAGTTTCACACTTGCTGTAAATCGTACATTTACAAATGCAAAAGGTGAACGTGAAGCGGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGCCGTATAAAATCACGT
AGTTATGAAAATAAAGATGGGCAACGCGTATATGTCACAGAAGTGATTTGTGACAGTGTTCAGTTTCTTGAAAGCAAATC
TACTAATAGCAATCAATCACAAGGCGGTATAGCATCCGGACAATATCAACCAAAAACAAATCATGTCGCTGCTACAAGTC
AAAATCCATTTGTTAATACGAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
ATGATTAATAGAGTTGTACTTGTAGGAAGATTAACTAAAAATCCTGATTTAAGACATACACCAAACGGAATAAGTGTTAG
CAGTTTCACACTTGCTGTAAATCGTACATTTACAAATGCAAAAGGTGAACGTGAAGCGGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGCCGTATAAAATCACGT
AGTTATGAAAATAAAGATGGGCAACGCGTATATGTCACAGAAGTGATTTGTGACAGTGTTCAGTTTCTTGAAAGCAAATC
TACTAATAGCAATCAATCACAAGGCGGTATAGCATCCGGACAATATCAACCAAAAACAAATCATGTCGCTGCTACAAGTC
AAAATCCATTTGTTAATACGAATGATTCAATTGATATTAGTGACGACGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.614 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.595 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
69.281 |
0.418 |