Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   I8N73_RS12910 Genome accession   NZ_CP065791
Coordinates   2663752..2664189 (-) Length   145 a.a.
NCBI ID   WP_094032243.1    Uniprot ID   -
Organism   Bacillus velezensis strain LBUM279     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2658752..2669189
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I8N73_RS12860 (I8N73_12860) sinI 2659136..2659309 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  I8N73_RS12865 (I8N73_12865) sinR 2659343..2659678 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  I8N73_RS12870 (I8N73_12870) tasA 2659726..2660511 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  I8N73_RS12875 (I8N73_12875) sipW 2660576..2661160 (-) 585 WP_199022043.1 signal peptidase I SipW -
  I8N73_RS12880 (I8N73_12880) tapA 2661132..2661803 (-) 672 WP_064115390.1 amyloid fiber anchoring/assembly protein TapA -
  I8N73_RS12885 (I8N73_12885) - 2662062..2662391 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  I8N73_RS12890 (I8N73_12890) - 2662431..2662610 (-) 180 WP_003153093.1 YqzE family protein -
  I8N73_RS12895 (I8N73_12895) comGG 2662667..2663044 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  I8N73_RS12900 (I8N73_12900) comGF 2663045..2663440 (-) 396 WP_064115389.1 competence type IV pilus minor pilin ComGF -
  I8N73_RS12905 (I8N73_12905) comGE 2663454..2663768 (-) 315 WP_064115388.1 competence type IV pilus minor pilin ComGE -
  I8N73_RS12910 (I8N73_12910) comGD 2663752..2664189 (-) 438 WP_094032243.1 competence type IV pilus minor pilin ComGD Machinery gene
  I8N73_RS12915 (I8N73_12915) comGC 2664179..2664487 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  I8N73_RS12920 (I8N73_12920) comGB 2664492..2665529 (-) 1038 WP_199022044.1 competence type IV pilus assembly protein ComGB Machinery gene
  I8N73_RS12925 (I8N73_12925) comGA 2665516..2666586 (-) 1071 WP_043020785.1 competence type IV pilus ATPase ComGA Machinery gene
  I8N73_RS12930 (I8N73_12930) - 2666783..2667733 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  I8N73_RS12935 (I8N73_12935) - 2667879..2669180 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.72 Da        Isoelectric Point: 10.2172

>NTDB_id=514552 I8N73_RS12910 WP_094032243.1 2663752..2664189(-) (comGD) [Bacillus velezensis strain LBUM279]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPACTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHRYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=514552 I8N73_RS12910 WP_094032243.1 2663752..2664189(-) (comGD) [Bacillus velezensis strain LBUM279]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACAGTTTTGTTCACGACGGTTCCGCCGGCCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAGATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATCCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566