Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | I8N73_RS12860 | Genome accession | NZ_CP065791 |
| Coordinates | 2659136..2659309 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain LBUM279 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2654136..2664309
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I8N73_RS12845 (I8N73_12845) | gcvT | 2654949..2656049 (-) | 1101 | WP_025284994.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| I8N73_RS12850 (I8N73_12850) | - | 2656473..2658143 (+) | 1671 | WP_199022041.1 | DEAD/DEAH box helicase | - |
| I8N73_RS12855 (I8N73_12855) | - | 2658165..2658959 (+) | 795 | WP_199022042.1 | YqhG family protein | - |
| I8N73_RS12860 (I8N73_12860) | sinI | 2659136..2659309 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| I8N73_RS12865 (I8N73_12865) | sinR | 2659343..2659678 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| I8N73_RS12870 (I8N73_12870) | tasA | 2659726..2660511 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| I8N73_RS12875 (I8N73_12875) | sipW | 2660576..2661160 (-) | 585 | WP_199022043.1 | signal peptidase I SipW | - |
| I8N73_RS12880 (I8N73_12880) | tapA | 2661132..2661803 (-) | 672 | WP_064115390.1 | amyloid fiber anchoring/assembly protein TapA | - |
| I8N73_RS12885 (I8N73_12885) | - | 2662062..2662391 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| I8N73_RS12890 (I8N73_12890) | - | 2662431..2662610 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| I8N73_RS12895 (I8N73_12895) | comGG | 2662667..2663044 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| I8N73_RS12900 (I8N73_12900) | comGF | 2663045..2663440 (-) | 396 | WP_064115389.1 | competence type IV pilus minor pilin ComGF | - |
| I8N73_RS12905 (I8N73_12905) | comGE | 2663454..2663768 (-) | 315 | WP_064115388.1 | competence type IV pilus minor pilin ComGE | - |
| I8N73_RS12910 (I8N73_12910) | comGD | 2663752..2664189 (-) | 438 | WP_094032243.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=514549 I8N73_RS12860 WP_003153105.1 2659136..2659309(+) (sinI) [Bacillus velezensis strain LBUM279]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=514549 I8N73_RS12860 WP_003153105.1 2659136..2659309(+) (sinI) [Bacillus velezensis strain LBUM279]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |