Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   I8N73_RS12860 Genome accession   NZ_CP065791
Coordinates   2659136..2659309 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain LBUM279     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2654136..2664309
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I8N73_RS12845 (I8N73_12845) gcvT 2654949..2656049 (-) 1101 WP_025284994.1 glycine cleavage system aminomethyltransferase GcvT -
  I8N73_RS12850 (I8N73_12850) - 2656473..2658143 (+) 1671 WP_199022041.1 DEAD/DEAH box helicase -
  I8N73_RS12855 (I8N73_12855) - 2658165..2658959 (+) 795 WP_199022042.1 YqhG family protein -
  I8N73_RS12860 (I8N73_12860) sinI 2659136..2659309 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  I8N73_RS12865 (I8N73_12865) sinR 2659343..2659678 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  I8N73_RS12870 (I8N73_12870) tasA 2659726..2660511 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  I8N73_RS12875 (I8N73_12875) sipW 2660576..2661160 (-) 585 WP_199022043.1 signal peptidase I SipW -
  I8N73_RS12880 (I8N73_12880) tapA 2661132..2661803 (-) 672 WP_064115390.1 amyloid fiber anchoring/assembly protein TapA -
  I8N73_RS12885 (I8N73_12885) - 2662062..2662391 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  I8N73_RS12890 (I8N73_12890) - 2662431..2662610 (-) 180 WP_003153093.1 YqzE family protein -
  I8N73_RS12895 (I8N73_12895) comGG 2662667..2663044 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  I8N73_RS12900 (I8N73_12900) comGF 2663045..2663440 (-) 396 WP_064115389.1 competence type IV pilus minor pilin ComGF -
  I8N73_RS12905 (I8N73_12905) comGE 2663454..2663768 (-) 315 WP_064115388.1 competence type IV pilus minor pilin ComGE -
  I8N73_RS12910 (I8N73_12910) comGD 2663752..2664189 (-) 438 WP_094032243.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=514549 I8N73_RS12860 WP_003153105.1 2659136..2659309(+) (sinI) [Bacillus velezensis strain LBUM279]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=514549 I8N73_RS12860 WP_003153105.1 2659136..2659309(+) (sinI) [Bacillus velezensis strain LBUM279]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702