Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | I8N72_RS11665 | Genome accession | NZ_CP065790 |
| Coordinates | 2437430..2437603 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain LBUM1082 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2432430..2442603
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I8N72_RS11650 (I8N72_11650) | gcvT | 2433248..2434348 (-) | 1101 | WP_015388009.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| I8N72_RS11655 (I8N72_11655) | - | 2434771..2436441 (+) | 1671 | WP_003153107.1 | DEAD/DEAH box helicase | - |
| I8N72_RS11660 (I8N72_11660) | - | 2436459..2437253 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| I8N72_RS11665 (I8N72_11665) | sinI | 2437430..2437603 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| I8N72_RS11670 (I8N72_11670) | sinR | 2437637..2437972 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| I8N72_RS11675 (I8N72_11675) | tasA | 2438020..2438805 (-) | 786 | WP_015388008.1 | biofilm matrix protein TasA | - |
| I8N72_RS11680 (I8N72_11680) | sipW | 2438869..2439453 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| I8N72_RS11685 (I8N72_11685) | tapA | 2439425..2440096 (-) | 672 | WP_015388007.1 | amyloid fiber anchoring/assembly protein TapA | - |
| I8N72_RS11690 (I8N72_11690) | - | 2440356..2440685 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| I8N72_RS11695 (I8N72_11695) | - | 2440725..2440904 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| I8N72_RS11700 (I8N72_11700) | comGG | 2440961..2441338 (-) | 378 | WP_015388005.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| I8N72_RS11705 (I8N72_11705) | comGF | 2441339..2441734 (-) | 396 | WP_015388004.1 | competence type IV pilus minor pilin ComGF | - |
| I8N72_RS11710 (I8N72_11710) | comGE | 2441748..2442062 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| I8N72_RS11715 (I8N72_11715) | comGD | 2442046..2442483 (-) | 438 | WP_015388002.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=514475 I8N72_RS11665 WP_003153105.1 2437430..2437603(+) (sinI) [Bacillus velezensis strain LBUM1082]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=514475 I8N72_RS11665 WP_003153105.1 2437430..2437603(+) (sinI) [Bacillus velezensis strain LBUM1082]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |