Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   I8N72_RS11710 Genome accession   NZ_CP065790
Coordinates   2441748..2442062 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain LBUM1082     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2436748..2447062
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I8N72_RS11665 (I8N72_11665) sinI 2437430..2437603 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  I8N72_RS11670 (I8N72_11670) sinR 2437637..2437972 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  I8N72_RS11675 (I8N72_11675) tasA 2438020..2438805 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  I8N72_RS11680 (I8N72_11680) sipW 2438869..2439453 (-) 585 WP_012117977.1 signal peptidase I SipW -
  I8N72_RS11685 (I8N72_11685) tapA 2439425..2440096 (-) 672 WP_015388007.1 amyloid fiber anchoring/assembly protein TapA -
  I8N72_RS11690 (I8N72_11690) - 2440356..2440685 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  I8N72_RS11695 (I8N72_11695) - 2440725..2440904 (-) 180 WP_003153093.1 YqzE family protein -
  I8N72_RS11700 (I8N72_11700) comGG 2440961..2441338 (-) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  I8N72_RS11705 (I8N72_11705) comGF 2441339..2441734 (-) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  I8N72_RS11710 (I8N72_11710) comGE 2441748..2442062 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  I8N72_RS11715 (I8N72_11715) comGD 2442046..2442483 (-) 438 WP_015388002.1 competence type IV pilus minor pilin ComGD Machinery gene
  I8N72_RS11720 (I8N72_11720) comGC 2442473..2442781 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  I8N72_RS11725 (I8N72_11725) comGB 2442786..2443823 (-) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  I8N72_RS11730 (I8N72_11730) comGA 2443810..2444880 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  I8N72_RS11735 (I8N72_11735) - 2445072..2446022 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=514478 I8N72_RS11710 WP_015388003.1 2441748..2442062(-) (comGE) [Bacillus velezensis strain LBUM1082]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=514478 I8N72_RS11710 WP_015388003.1 2441748..2442062(-) (comGE) [Bacillus velezensis strain LBUM1082]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGCGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481