Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   I8N71_RS17165 Genome accession   NZ_CP065789
Coordinates   3255455..3255622 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain LBUM979     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250455..3260622
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I8N71_RS17135 (I8N71_17135) mrpE 3250851..3251327 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  I8N71_RS17140 (I8N71_17140) mrpF 3251327..3251611 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  I8N71_RS17145 (I8N71_17145) mnhG 3251595..3251969 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  I8N71_RS17150 (I8N71_17150) yuxO 3252008..3252388 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  I8N71_RS17155 (I8N71_17155) comA 3252407..3253051 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  I8N71_RS17160 (I8N71_17160) comP 3253132..3255440 (-) 2309 Protein_3330 two-component system sensor histidine kinase ComP -
  I8N71_RS17165 (I8N71_17165) comX 3255455..3255622 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  I8N71_RS17170 (I8N71_17170) comQ 3255610..3256509 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  I8N71_RS17175 (I8N71_17175) degQ 3256694..3256834 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  I8N71_RS17180 (I8N71_17180) - 3257056..3257181 (+) 126 WP_003228793.1 hypothetical protein -
  I8N71_RS17185 (I8N71_17185) - 3257295..3257663 (+) 369 WP_003243784.1 hypothetical protein -
  I8N71_RS17190 (I8N71_17190) pdeH 3257639..3258868 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  I8N71_RS17195 (I8N71_17195) pncB 3259005..3260477 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=514418 I8N71_RS17165 WP_003242801.1 3255455..3255622(-) (comX) [Bacillus subtilis strain LBUM979]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=514418 I8N71_RS17165 WP_003242801.1 3255455..3255622(-) (comX) [Bacillus subtilis strain LBUM979]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1