Detailed information NTG0051434

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: LLNZ_RS12030
• Genome accession: NC_017949
• Coordinates: 2344362..2344661 (-)
• Length: 99 a.a.
• NCBI ID: WP_011836042.1
• Uniprot ID: A2RNS3
• Organism: Lactococcus cremoris subsp. cremoris NZ9000
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	2339819..2353784	2344362..2344661	within	0

Gene organization within MGE regions

Location: 2339819..2353784

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLNZ_RS13310	-	2339819..2341214 (-)	1396	Protein_2339	IS3 family transposase	-
LLNZ_RS12010 (LLNZ_12395)	-	2341287..2342096 (-)	810	WP_011836038.1	metal ABC transporter permease	-
LLNZ_RS12015 (LLNZ_12400)	-	2342089..2342826 (-)	738	WP_011836039.1	metal ABC transporter ATP-binding protein	-
LLNZ_RS12020 (LLNZ_12405)	-	2343005..2343847 (-)	843	WP_011836040.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LLNZ_RS12025 (LLNZ_12410)	-	2343844..2344281 (-)	438	WP_011836041.1	zinc-dependent MarR family transcriptional regulator	-
LLNZ_RS12030 (LLNZ_12415)	comGG	2344362..2344661 (-)	300	WP_011836042.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLNZ_RS12035 (LLNZ_12420)	comGF	2344685..2345110 (-)	426	WP_014735174.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLNZ_RS12040 (LLNZ_12425)	comGE	2345094..2345390 (-)	297	WP_014735175.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLNZ_RS12045 (LLNZ_12430)	comGD	2345362..2345805 (-)	444	WP_011836045.1	competence type IV pilus minor pilin ComGD	Machinery gene
LLNZ_RS12050 (LLNZ_12435)	comGC	2345753..2346130 (-)	378	WP_011836046.1	competence type IV pilus major pilin ComGC	Machinery gene
LLNZ_RS12055 (LLNZ_12440)	comGB	2346148..2347173 (-)	1026	WP_042211510.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLNZ_RS12060 (LLNZ_12445)	comGA	2347073..2348053 (-)	981	WP_011836048.1	competence type IV pilus ATPase ComGA	Machinery gene
LLNZ_RS12065 (LLNZ_12450)	-	2348167..2351949 (-)	3783	Protein_2351	PolC-type DNA polymerase III	-
LLNZ_RS14065	-	2352481..2353074 (-)	594	Protein_2352	PolC-type DNA polymerase III N-terminal domain-containing protein	-
LLNZ_RS12070 (LLNZ_12455)	-	2353248..2353784 (-)	537	WP_011836050.1	hypothetical protein	-

Sequence

Protein

• Length: 99 a.a.
• Molecular weight: 11211.23 Da
• Isoelectric Point: 10.0446

>NTDB_id=51434 LLNZ_RS12030 WP_011836042.1 2344362..2344661(-) (comGG) [Lactococcus cremoris subsp. cremoris NZ9000]
MVLLLIFSLFLQFYLQKQVLTAQQLKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSAGSTSGGQTVSN
KTYCFDVRLKDGRIFQIKK

Nucleotide

• Length: 300 bp

>NTDB_id=51434 LLNZ_RS12030 WP_011836042.1 2344362..2344661(-) (comGG) [Lactococcus cremoris subsp. cremoris NZ9000]
TTGGTTTTACTGCTAATTTTTTCTTTATTTCTACAGTTTTATTTGCAAAAACAGGTGCTTACAGCTCAGCAATTGAAAAT
AGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCAACTTAATT
TTGATTGTGGAAATTTAACTTATAAATTACTGACAGATCTGTCAGCTGGTTCAACTAGCGGTGGTCAAACTGTTAGTAAT
AAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGGATTTTTCAAATAAAAAAGTAA

Domains

No domain identified.

3D structure

• AlphaFold DB: A2RNS3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Lactococcus lactis subsp. cremoris KW2	98.99	100	0.99