Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | Y1U_RS11620 | Genome accession | NC_017927 |
| Coordinates | 262360..262569 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus MN-ZLW-002 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 257360..267569
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Y1U_RS01435 (Y1U_C0255) | - | 257798..258307 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| Y1U_RS01440 (Y1U_C0256) | - | 258619..259176 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| Y1U_RS01445 (Y1U_C0257) | - | 259179..259829 (+) | 651 | WP_014727315.1 | phosphatase PAP2 family protein | - |
| Y1U_RS01450 (Y1U_C0258) | comR | 260024..260923 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| Y1U_RS11610 | - | 261161..261592 (+) | 432 | Protein_236 | cysteine peptidase family C39 domain-containing protein | - |
| Y1U_RS11615 | - | 261622..262287 (+) | 666 | Protein_237 | ABC transporter transmembrane domain-containing protein | - |
| Y1U_RS11620 (Y1U_C0261) | comA | 262360..262569 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| Y1U_RS01475 (Y1U_C0262) | - | 262624..263192 (+) | 569 | Protein_239 | ATP-binding cassette domain-containing protein | - |
| Y1U_RS01480 (Y1U_C0263) | - | 263300..263617 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| Y1U_RS11625 (Y1U_C0264) | - | 263580..263864 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| Y1U_RS11630 (Y1U_C0265) | - | 264104..265000 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| Y1U_RS01490 (Y1U_C0266) | - | 265405..265920 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| Y1U_RS01495 (Y1U_C0267) | - | 265945..266247 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| Y1U_RS01500 (Y1U_C0268) | - | 266259..266570 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=51360 Y1U_RS11620 WP_002946147.1 262360..262569(+) (comA) [Streptococcus thermophilus MN-ZLW-002]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=51360 Y1U_RS11620 WP_002946147.1 262360..262569(+) (comA) [Streptococcus thermophilus MN-ZLW-002]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |