Detailed information
Bioinformatically predicted
Overview
| Name | comC/blpC | Type | Regulator |
| Locus tag | SMULJ23_RS01400 | Genome accession | NC_017768 |
| Coordinates | 310923..311063 (-) | Length | 46 a.a. |
| NCBI ID | WP_002270250.1 | Uniprot ID | Q9APK7 |
| Organism | Streptococcus mutans LJ23 | ||
| Function | binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology) Competence regulation |
||
Genomic Context
Location: 305923..316063
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SMULJ23_RS01380 (SMULJ23_0257) | - | 306923..307549 (+) | 627 | WP_014677755.1 | hypothetical protein | - |
| SMULJ23_RS01385 (SMULJ23_0258) | - | 307597..308235 (+) | 639 | WP_002292006.1 | VTT domain-containing protein | - |
| SMULJ23_RS01390 (SMULJ23_0259) | comE/blpR | 308707..309459 (+) | 753 | WP_002262114.1 | response regulator transcription factor | Regulator |
| SMULJ23_RS01395 (SMULJ23_0260) | comD/blpH | 309456..310781 (+) | 1326 | WP_002292008.1 | GHKL domain-containing protein | Regulator |
| SMULJ23_RS01400 (SMULJ23_0261) | comC/blpC | 310923..311063 (-) | 141 | WP_002270250.1 | ComC/BlpC family leader-containing pheromone/bacteriocin | Regulator |
| SMULJ23_RS01405 (SMULJ23_0262) | cipB | 311330..311560 (+) | 231 | WP_002265368.1 | Blp family class II bacteriocin | Regulator |
| SMULJ23_RS01410 (SMULJ23_0263) | - | 311691..312092 (+) | 402 | WP_002310604.1 | hypothetical protein | - |
| SMULJ23_RS01415 (SMULJ23_0265) | - | 313473..313886 (+) | 414 | Protein_260 | hypothetical protein | - |
| SMULJ23_RS01420 (SMULJ23_0266) | - | 314038..314442 (+) | 405 | WP_002263912.1 | hypothetical protein | - |
| SMULJ23_RS10710 | - | 314565..314777 (-) | 213 | Protein_262 | IS3 family transposase | - |
| SMULJ23_RS10590 (SMULJ23_0268) | - | 315217..315381 (+) | 165 | WP_002265308.1 | hypothetical protein | - |
| SMULJ23_RS01430 (SMULJ23_0271) | - | 315786..315998 (+) | 213 | WP_002264173.1 | Blp family class II bacteriocin | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5195.02 Da Isoelectric Point: 10.4929
>NTDB_id=50742 SMULJ23_RS01400 WP_002270250.1 310923..311063(-) (comC/blpC) [Streptococcus mutans LJ23]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK
Nucleotide
Download Length: 141 bp
>NTDB_id=50742 SMULJ23_RS01400 WP_002270250.1 310923..311063(-) (comC/blpC) [Streptococcus mutans LJ23]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/blpC | Streptococcus mutans UA159 |
97.826 |
100 |
0.978 |