Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IRJ20_RS04885 Genome accession   NZ_CP065137
Coordinates   932000..932140 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus sp. A1(2020)     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 927000..937140
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ20_RS04860 - 927298..927681 (-) 384 WP_040238946.1 hotdog fold thioesterase -
  IRJ20_RS04865 comA 927703..928347 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  IRJ20_RS04870 comP 928428..930731 (-) 2304 WP_040238945.1 histidine kinase Regulator
  IRJ20_RS04875 comX 930751..930921 (-) 171 WP_003152048.1 competence pheromone ComX Regulator
  IRJ20_RS04880 comQ 930952..931869 (-) 918 WP_278189317.1 class 1 isoprenoid biosynthesis enzyme Regulator
  IRJ20_RS04885 degQ 932000..932140 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  IRJ20_RS04890 - 932603..932944 (+) 342 WP_015418107.1 hypothetical protein -
  IRJ20_RS04895 - 932951..934174 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  IRJ20_RS04900 - 934304..935770 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  IRJ20_RS04905 - 935788..936339 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  IRJ20_RS04910 - 936436..936834 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=507215 IRJ20_RS04885 WP_003152043.1 932000..932140(-) (degQ) [Bacillus sp. A1(2020)]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=507215 IRJ20_RS04885 WP_003152043.1 932000..932140(-) (degQ) [Bacillus sp. A1(2020)]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891