Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HCD_RS09485 Genome accession   NC_017735
Coordinates   19920..20033 (-) Length   37 a.a.
NCBI ID   WP_014658579.1    Uniprot ID   I0EQ31
Organism   Helicobacter cetorum MIT 99-5656     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 14920..25033
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCD_RS00095 - 15670..17087 (-) 1418 Protein_15 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HCD_RS00100 (HCD_00075) comB10 17127..18260 (-) 1134 WP_014658576.1 DNA type IV secretion system protein ComB10 Machinery gene
  HCD_RS00105 (HCD_00080) comB9 18257..19186 (-) 930 WP_014658577.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HCD_RS00110 (HCD_00085) comB8 19186..19923 (-) 738 WP_014658578.1 type IV secretion system protein Machinery gene
  HCD_RS09485 (HCD_00090) comB7 19920..20033 (-) 114 WP_014658579.1 hypothetical protein Machinery gene
  HCD_RS00115 (HCD_00095) comB6 20049..21095 (-) 1047 WP_014658580.1 P-type conjugative transfer protein TrbL Machinery gene
  HCD_RS00120 (HCD_00100) - 21095..22090 (-) 996 WP_014658581.1 PDZ domain-containing protein -
  HCD_RS00125 (HCD_00105) - 22090..22383 (-) 294 WP_014658582.1 YbaB/EbfC family nucleoid-associated protein -
  HCD_RS00130 (HCD_00110) panD 22386..22742 (-) 357 WP_014658583.1 aspartate 1-decarboxylase -
  HCD_RS00135 (HCD_00115) - 22732..24945 (-) 2214 WP_014658584.1 AAA family ATPase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4115.04 Da        Isoelectric Point: 8.5386

>NTDB_id=50459 HCD_RS09485 WP_014658579.1 19920..20033(-) (comB7) [Helicobacter cetorum MIT 99-5656]
MKIFFVILGLVLLGCSSKVHEMKKSPCAFYENPLSLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=50459 HCD_RS09485 WP_014658579.1 19920..20033(-) (comB7) [Helicobacter cetorum MIT 99-5656]
ATGAAAATTTTTTTTGTTATTCTTGGGCTTGTGTTGTTAGGTTGCTCCAGCAAGGTGCATGAAATGAAGAAAAGCCCCTG
TGCATTCTATGAAAACCCACTGAGTCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I0EQ31

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

75.676

100

0.757

Multiple sequence alignment