Detailed information    

insolico Bioinformatically predicted

Overview

Name   comK/comK1   Type   Regulator
Locus tag   HWI33_RS08840 Genome accession   NZ_CP064563
Coordinates   1856654..1857229 (-) Length   191 a.a.
NCBI ID   WP_001829272.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain UMCG360     
Function   promote expression of competence genes (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1814531..1856253 1856654..1857229 flank 401


Gene organization within MGE regions


Location: 1814531..1857229
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWI33_RS08510 (HWI33_08450) - 1814531..1815457 (-) 927 WP_012099593.1 hypothetical protein -
  HWI33_RS08515 (HWI33_08455) - 1815535..1816917 (-) 1383 WP_012099594.1 N-acetylmuramoyl-L-alanine amidase -
  HWI33_RS08520 (HWI33_08460) - 1816917..1817183 (-) 267 WP_124759736.1 phage holin -
  HWI33_RS08525 (HWI33_08465) - 1817245..1817391 (-) 147 WP_049387152.1 XkdX family protein -
  HWI33_RS08530 (HWI33_08470) - 1817384..1817737 (-) 354 WP_002439245.1 hypothetical protein -
  HWI33_RS08535 (HWI33_08475) - 1817749..1818903 (-) 1155 WP_237614787.1 BppU family phage baseplate upper protein -
  HWI33_RS08540 (HWI33_08480) - 1818958..1820736 (-) 1779 Protein_1648 glucosaminidase domain-containing protein -
  HWI33_RS08545 (HWI33_08485) - 1821235..1821534 (-) 300 WP_064604136.1 DUF2951 family protein -
  HWI33_RS08550 (HWI33_08490) - 1821608..1823437 (-) 1830 WP_408022949.1 phage baseplate upper protein -
  HWI33_RS08555 (HWI33_08495) - 1823437..1825338 (-) 1902 WP_408022950.1 hypothetical protein -
  HWI33_RS08560 (HWI33_08500) - 1825353..1827209 (-) 1857 WP_241525995.1 SGNH/GDSL hydrolase family protein -
  HWI33_RS08565 (HWI33_08505) - 1827223..1828161 (-) 939 WP_408022951.1 phage tail protein -
  HWI33_RS08570 (HWI33_08510) - 1828177..1831281 (-) 3105 WP_408022952.1 terminase -
  HWI33_RS08575 (HWI33_08515) - 1831284..1831586 (-) 303 WP_049371044.1 hypothetical protein -
  HWI33_RS08580 (HWI33_08520) - 1831649..1832143 (-) 495 WP_049371046.1 tail assembly chaperone -
  HWI33_RS08585 (HWI33_08525) - 1832206..1832745 (-) 540 WP_151507890.1 phage tail protein -
  HWI33_RS08590 (HWI33_08530) - 1832732..1833169 (-) 438 WP_049372077.1 DUF3168 domain-containing protein -
  HWI33_RS08595 (HWI33_08535) - 1833182..1833595 (-) 414 WP_001830232.1 HK97-gp10 family putative phage morphogenesis protein -
  HWI33_RS08600 (HWI33_08540) - 1833588..1833917 (-) 330 WP_001830290.1 phage head closure protein -
  HWI33_RS08605 (HWI33_08545) - 1833910..1834224 (-) 315 WP_001830262.1 phage head-tail connector protein -
  HWI33_RS08610 (HWI33_08550) - 1834224..1834514 (-) 291 WP_001830272.1 Rho termination factor N-terminal domain-containing protein -
  HWI33_RS08615 (HWI33_08555) - 1834531..1835361 (-) 831 WP_119559190.1 N4-gp56 family major capsid protein -
  HWI33_RS08620 (HWI33_08560) - 1835379..1835975 (-) 597 WP_151507888.1 phage scaffolding protein -
  HWI33_RS08625 (HWI33_08565) - 1836091..1836297 (-) 207 WP_049388126.1 hypothetical protein -
  HWI33_RS08630 (HWI33_08570) - 1836409..1837371 (-) 963 WP_408022953.1 phage head morphogenesis protein -
  HWI33_RS08635 (HWI33_08575) - 1837328..1838764 (-) 1437 WP_408022954.1 phage portal protein -
  HWI33_RS08640 (HWI33_08580) - 1838770..1840038 (-) 1269 WP_063280139.1 PBSX family phage terminase large subunit -
  HWI33_RS08645 (HWI33_08585) - 1840047..1840535 (-) 489 WP_012097732.1 terminase small subunit -
  HWI33_RS08650 (HWI33_08590) - 1840984..1841400 (-) 417 WP_002439197.1 hypothetical protein -
  HWI33_RS08655 (HWI33_08595) - 1841418..1841636 (-) 219 WP_001830276.1 hypothetical protein -
  HWI33_RS08660 (HWI33_08600) - 1841640..1841780 (-) 141 WP_002469471.1 hypothetical protein -
  HWI33_RS08665 (HWI33_08605) - 1841768..1842166 (-) 399 WP_002468964.1 hypothetical protein -
  HWI33_RS08670 (HWI33_08610) rinB 1842168..1842338 (-) 171 WP_002504969.1 transcriptional activator RinB -
  HWI33_RS08675 (HWI33_08615) - 1842331..1842483 (-) 153 WP_154814141.1 hypothetical protein -
  HWI33_RS08680 (HWI33_08620) - 1842496..1842699 (-) 204 WP_002504970.1 DUF1381 domain-containing protein -
  HWI33_RS08685 (HWI33_08625) dut 1842736..1843158 (-) 423 WP_134293135.1 dUTP diphosphatase -
  HWI33_RS08690 (HWI33_08630) - 1843159..1843356 (-) 198 WP_053020572.1 Lar family restriction alleviation protein -
  HWI33_RS08695 (HWI33_08635) - 1843349..1843579 (-) 231 Protein_1679 hypothetical protein -
  HWI33_RS08700 (HWI33_08640) - 1843779..1844180 (-) 402 WP_134293134.1 hypothetical protein -
  HWI33_RS08705 - 1844167..1844364 (-) 198 WP_134293133.1 hypothetical protein -
  HWI33_RS08710 (HWI33_08645) - 1844351..1844965 (-) 615 WP_002470858.1 HNH endonuclease signature motif containing protein -
  HWI33_RS08715 (HWI33_08650) - 1844971..1845201 (-) 231 WP_001830240.1 hypothetical protein -
  HWI33_RS08720 (HWI33_08655) - 1845206..1845649 (-) 444 WP_134293132.1 DUF3310 domain-containing protein -
  HWI33_RS08725 (HWI33_08660) - 1845646..1846005 (-) 360 WP_061827613.1 SA1788 family PVL leukocidin-associated protein -
  HWI33_RS08730 (HWI33_08665) - 1846006..1846197 (-) 192 WP_049368573.1 hypothetical protein -
  HWI33_RS08735 (HWI33_08670) - 1846197..1846571 (-) 375 WP_002470844.1 hypothetical protein -
  HWI33_RS08740 (HWI33_08675) - 1846558..1846974 (-) 417 WP_002470845.1 DUF1064 domain-containing protein -
  HWI33_RS08745 (HWI33_08680) - 1846985..1847209 (-) 225 WP_002456377.1 DUF3269 family protein -
  HWI33_RS08750 (HWI33_08685) - 1847178..1847408 (-) 231 WP_408022955.1 hypothetical protein -
  HWI33_RS08755 (HWI33_08690) - 1847405..1848652 (-) 1248 WP_001830247.1 DnaB-like helicase C-terminal domain-containing protein -
  HWI33_RS08760 (HWI33_08695) - 1848642..1848995 (-) 354 WP_002456374.1 hypothetical protein -
  HWI33_RS08765 (HWI33_08700) - 1849001..1849702 (-) 702 WP_002439167.1 helix-turn-helix domain-containing protein -
  HWI33_RS08770 (HWI33_08705) - 1849699..1850373 (-) 675 WP_002439166.1 putative HNHc nuclease -
  HWI33_RS08775 (HWI33_08710) - 1850387..1850794 (-) 408 WP_194376917.1 single-stranded DNA-binding protein -
  HWI33_RS08780 (HWI33_08715) - 1850791..1851438 (-) 648 WP_194376918.1 ERF family protein -
  HWI33_RS08785 (HWI33_08720) - 1851431..1851655 (-) 225 WP_001830261.1 DUF2483 family protein -
  HWI33_RS08790 (HWI33_08725) - 1851627..1851902 (-) 276 WP_194376919.1 chordopoxvirus fusion protein -
  HWI33_RS08795 (HWI33_08730) - 1851957..1852133 (-) 177 WP_194376920.1 hypothetical protein -
  HWI33_RS08800 (HWI33_08735) - 1852191..1852400 (-) 210 WP_046026347.1 hypothetical protein -
  HWI33_RS08805 (HWI33_08740) - 1852413..1853129 (-) 717 WP_002468739.1 phage repressor protein -
  HWI33_RS08810 (HWI33_08745) - 1853143..1853358 (-) 216 WP_001830251.1 transcriptional regulator -
  HWI33_RS08815 (HWI33_08750) - 1853555..1854166 (+) 612 WP_002468741.1 LexA family transcriptional regulator -
  HWI33_RS08820 (HWI33_08755) - 1854222..1855145 (+) 924 WP_002470864.1 DUF5067 domain-containing protein -
  HWI33_RS08825 (HWI33_08760) - 1855204..1856253 (+) 1050 WP_049385685.1 site-specific integrase -
  HWI33_RS08840 (HWI33_08775) comK/comK1 1856654..1857229 (-) 576 WP_001829272.1 competence protein ComK Regulator

Sequence

Protein


Download         Length: 191 a.a.        Molecular weight: 22782.87 Da        Isoelectric Point: 9.2887

>NTDB_id=503128 HWI33_RS08840 WP_001829272.1 1856654..1857229(-) (comK/comK1) [Staphylococcus epidermidis strain UMCG360]
MTHLPETIYVIRKGDMVIRPKYDEYQQTNGTEIIRFDQTRKESPFKVQRIIERSCKFYGNNYISKKAETNRITGISSKPP
ILLTPLFPTYFFPTHSDRQEENIWINMHYIENVKELKNRKSKIIFANGDSLTLNVSFHSLWHQYTNAIIYYYMVDKQSRM
KSNNPEQPIDYNQSSLNIFEALSRYSLFEEN

Nucleotide


Download         Length: 576 bp        

>NTDB_id=503128 HWI33_RS08840 WP_001829272.1 1856654..1857229(-) (comK/comK1) [Staphylococcus epidermidis strain UMCG360]
ATGACACATTTACCCGAAACGATTTATGTTATACGAAAAGGTGATATGGTAATACGACCTAAATATGATGAATATCAGCA
AACAAATGGTACTGAAATTATCAGATTTGATCAAACTCGCAAAGAAAGTCCATTTAAAGTACAGAGAATTATCGAAAGAT
CATGTAAATTTTATGGTAATAATTATATTAGTAAAAAAGCAGAAACGAATCGTATTACTGGAATCTCTAGTAAACCACCT
ATTTTACTTACGCCTCTTTTTCCTACTTACTTTTTTCCAACTCACTCAGACCGTCAAGAAGAAAATATATGGATTAATAT
GCATTATATTGAAAATGTTAAAGAACTTAAAAATCGTAAGAGTAAAATAATTTTTGCGAATGGTGATTCGTTAACGCTCA
ATGTATCATTTCATAGCTTGTGGCATCAATATACGAATGCAATCATCTATTATTACATGGTAGATAAGCAATCACGAATG
AAATCTAACAACCCTGAACAACCCATTGACTATAATCAGTCTTCTCTAAATATTTTCGAGGCGCTCTCACGCTACTCCCT
TTTTGAAGAAAATTAG

Domains

Predicted by InterproScan.

ComK protein (ComK)

(7-158)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comK/comK1 Staphylococcus aureus MW2

76.757

96.859

0.743
  comK/comK1 Staphylococcus aureus N315

76.757

96.859

0.743