Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   HWI37_RS10550 Genome accession   NZ_CP064549
Coordinates   2207744..2208172 (-) Length   142 a.a.
NCBI ID   WP_002485832.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain UMCG364     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2173579..2215670 2207744..2208172 within 0


Gene organization within MGE regions


Location: 2173579..2215670
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWI37_RS10295 (HWI37_10220) hypR 2173579..2174001 (+) 423 WP_001832072.1 redox-sensitive transcriptional regulator HypR -
  HWI37_RS10300 (HWI37_10225) - 2174006..2174143 (+) 138 Protein_1996 FAD-binding protein -
  HWI37_RS10305 (HWI37_10230) - 2174387..2175790 (-) 1404 WP_408020866.1 N-acetylmuramoyl-L-alanine amidase -
  HWI37_RS10310 (HWI37_10235) - 2175790..2176059 (-) 270 WP_002469117.1 phage holin -
  HWI37_RS10315 (HWI37_10240) - 2176120..2176266 (-) 147 WP_002439246.1 XkdX family protein -
  HWI37_RS10320 (HWI37_10245) - 2176259..2176612 (-) 354 WP_237614788.1 hypothetical protein -
  HWI37_RS10325 (HWI37_10250) - 2176624..2177778 (-) 1155 WP_408020867.1 BppU family phage baseplate upper protein -
  HWI37_RS10330 (HWI37_10255) - 2177898..2178305 (-) 408 WP_408020868.1 hypothetical protein -
  HWI37_RS10335 (HWI37_10260) - 2178292..2178717 (-) 426 WP_002497615.1 hypothetical protein -
  HWI37_RS10340 (HWI37_10265) - 2178714..2179337 (-) 624 WP_408020869.1 poly-gamma-glutamate hydrolase family protein -
  HWI37_RS10345 (HWI37_10270) - 2179342..2180556 (-) 1215 WP_408020870.1 BppU family phage baseplate upper protein -
  HWI37_RS10350 (HWI37_10275) - 2180556..2182418 (-) 1863 WP_408020871.1 M14 family metallopeptidase -
  HWI37_RS10355 (HWI37_10280) - 2182434..2182607 (-) 174 WP_002504159.1 hypothetical protein -
  HWI37_RS10360 (HWI37_10285) - 2182600..2184159 (-) 1560 WP_408020872.1 prophage endopeptidase tail family protein -
  HWI37_RS10365 (HWI37_10290) - 2184169..2185002 (-) 834 WP_408020873.1 phage tail domain-containing protein -
  HWI37_RS10370 (HWI37_10295) - 2185004..2189761 (-) 4758 WP_408020874.1 phage tail tape measure protein -
  HWI37_RS10375 (HWI37_10300) gpGT 2189790..2189942 (-) 153 WP_154224849.1 phage tail assembly chaperone GT -
  HWI37_RS10380 (HWI37_10305) gpG 2189975..2190337 (-) 363 WP_002456406.1 phage tail assembly chaperone G -
  HWI37_RS10385 (HWI37_10310) - 2190407..2190592 (-) 186 WP_002456405.1 hypothetical protein -
  HWI37_RS10390 (HWI37_10315) - 2190611..2191240 (-) 630 WP_002485825.1 major tail protein -
  HWI37_RS10395 (HWI37_10320) - 2191253..2191657 (-) 405 WP_002485830.1 hypothetical protein -
  HWI37_RS10400 (HWI37_10325) - 2191662..2192066 (-) 405 WP_002456402.1 hypothetical protein -
  HWI37_RS10405 (HWI37_10330) - 2192063..2192392 (-) 330 WP_002456401.1 hypothetical protein -
  HWI37_RS10410 (HWI37_10335) - 2192382..2192723 (-) 342 WP_002456400.1 head-tail connector protein -
  HWI37_RS10415 (HWI37_10340) - 2192742..2194085 (-) 1344 WP_032603580.1 phage major capsid protein -
  HWI37_RS10420 (HWI37_10345) - 2194126..2194683 (-) 558 WP_002485849.1 HK97 family phage prohead protease -
  HWI37_RS10425 (HWI37_10350) - 2194676..2195905 (-) 1230 WP_408020875.1 phage portal protein -
  HWI37_RS10430 (HWI37_10355) - 2195908..2196102 (-) 195 WP_002500102.1 hypothetical protein -
  HWI37_RS10435 (HWI37_10360) - 2196114..2197808 (-) 1695 WP_408020876.1 terminase large subunit -
  HWI37_RS10440 (HWI37_10365) - 2197795..2198262 (-) 468 WP_002456394.1 phage terminase small subunit P27 family -
  HWI37_RS10445 (HWI37_10370) - 2198442..2198804 (-) 363 WP_408020877.1 HNH endonuclease -
  HWI37_RS10450 (HWI37_10375) - 2199380..2199793 (-) 414 WP_002485831.1 hypothetical protein -
  HWI37_RS10455 (HWI37_10380) - 2199807..2200028 (-) 222 WP_070867019.1 helix-turn-helix domain-containing protein -
  HWI37_RS10460 (HWI37_10385) - 2200049..2200267 (-) 219 WP_002488916.1 hypothetical protein -
  HWI37_RS10465 (HWI37_10390) - 2200281..2200469 (-) 189 WP_032602120.1 DUF1514 family protein -
  HWI37_RS10470 (HWI37_10395) rinB 2200543..2200719 (-) 177 WP_002488928.1 transcriptional activator RinB -
  HWI37_RS10475 (HWI37_10400) dut 2200768..2201193 (-) 426 WP_002488914.1 dUTP diphosphatase -
  HWI37_RS10480 (HWI37_10405) - 2201194..2201349 (-) 156 WP_203078913.1 hypothetical protein -
  HWI37_RS10485 (HWI37_10410) - 2201350..2201619 (-) 270 WP_002488920.1 hypothetical protein -
  HWI37_RS10490 (HWI37_10415) - 2201707..2202015 (-) 309 WP_002488933.1 hypothetical protein -
  HWI37_RS10495 (HWI37_10420) - 2202035..2202715 (-) 681 WP_408020878.1 hypothetical protein -
  HWI37_RS10500 (HWI37_10425) - 2202718..2203152 (-) 435 WP_408020879.1 DUF3310 domain-containing protein -
  HWI37_RS10505 (HWI37_10430) - 2203149..2203508 (-) 360 WP_151520740.1 SA1788 family PVL leukocidin-associated protein -
  HWI37_RS10510 (HWI37_10435) - 2203509..2203700 (-) 192 WP_237624951.1 hypothetical protein -
  HWI37_RS10515 (HWI37_10440) - 2203701..2204108 (-) 408 WP_002468165.1 RusA family crossover junction endodeoxyribonuclease -
  HWI37_RS10520 (HWI37_10445) - 2204117..2204362 (-) 246 WP_218086390.1 hypothetical protein -
  HWI37_RS10525 (HWI37_10450) - 2204340..2204561 (-) 222 WP_049387175.1 hypothetical protein -
  HWI37_RS10530 (HWI37_10455) - 2204558..2205805 (-) 1248 WP_002485837.1 DnaB-like helicase C-terminal domain-containing protein -
  HWI37_RS10535 (HWI37_10460) - 2205795..2206148 (-) 354 WP_408020880.1 hypothetical protein -
  HWI37_RS10540 (HWI37_10465) - 2206154..2206882 (-) 729 WP_408020881.1 DnaD domain protein -
  HWI37_RS10545 (HWI37_10470) - 2207047..2207730 (-) 684 WP_408020882.1 putative HNHc nuclease -
  HWI37_RS10550 (HWI37_10475) ssbA 2207744..2208172 (-) 429 WP_002485832.1 single-stranded DNA-binding protein Machinery gene
  HWI37_RS10555 (HWI37_10480) - 2208162..2208806 (-) 645 WP_408020883.1 DUF1071 domain-containing protein -
  HWI37_RS10560 (HWI37_10485) - 2208799..2209050 (-) 252 WP_002485808.1 hypothetical protein -
  HWI37_RS10565 (HWI37_10490) - 2209028..2209297 (-) 270 WP_002485840.1 hypothetical protein -
  HWI37_RS10570 (HWI37_10495) - 2209352..2209528 (-) 177 WP_002485827.1 hypothetical protein -
  HWI37_RS10575 (HWI37_10500) - 2209677..2209847 (-) 171 WP_002485823.1 hypothetical protein -
  HWI37_RS10580 (HWI37_10505) - 2209880..2210113 (-) 234 WP_002485855.1 MW1434 family type I TA system toxin -
  HWI37_RS10585 (HWI37_10510) - 2210148..2210642 (-) 495 WP_408020884.1 ORF6C domain-containing protein -
  HWI37_RS10590 (HWI37_10515) - 2210730..2210951 (-) 222 WP_408020885.1 hypothetical protein -
  HWI37_RS10595 (HWI37_10520) - 2210963..2211847 (-) 885 WP_408020886.1 hypothetical protein -
  HWI37_RS10600 (HWI37_10525) - 2211896..2212120 (+) 225 WP_408020887.1 hypothetical protein -
  HWI37_RS10605 (HWI37_10530) - 2212113..2212253 (-) 141 WP_002485815.1 hypothetical protein -
  HWI37_RS10610 (HWI37_10535) - 2212297..2212509 (-) 213 WP_002456362.1 helix-turn-helix transcriptional regulator -
  HWI37_RS10615 (HWI37_10540) - 2212662..2212976 (+) 315 WP_002504199.1 helix-turn-helix transcriptional regulator -
  HWI37_RS10620 (HWI37_10545) - 2212999..2213457 (+) 459 WP_002504200.1 ImmA/IrrE family metallo-endopeptidase -
  HWI37_RS10625 (HWI37_10550) - 2213475..2214143 (+) 669 WP_002504201.1 hypothetical protein -
  HWI37_RS10630 (HWI37_10555) - 2214294..2215670 (+) 1377 WP_408020888.1 recombinase family protein -

Sequence

Protein


Download         Length: 142 a.a.        Molecular weight: 15877.57 Da        Isoelectric Point: 6.3913

>NTDB_id=502985 HWI37_RS10550 WP_002485832.1 2207744..2208172(-) (ssbA) [Staphylococcus epidermidis strain UMCG364]
MLNRVVLVGRLTKDPEFRTTPSGVEVATFTLAVNRTFTNAQGEREADFINVVVFRKQAKNVNDYLSKGSLAGVDGRVQSR
NYENNEGRRVFVTEVVADSVQFLDTKGNNQQNNQPQKQQEPSATKYNPFANGTDMDSSELPF

Nucleotide


Download         Length: 429 bp        

>NTDB_id=502985 HWI37_RS10550 WP_002485832.1 2207744..2208172(-) (ssbA) [Staphylococcus epidermidis strain UMCG364]
ATGTTAAATAGAGTTGTATTAGTAGGAAGATTAACGAAAGATCCAGAGTTTAGAACTACGCCGAGTGGAGTTGAAGTAGC
GACATTCACATTAGCAGTAAACAGAACATTTACTAACGCACAAGGTGAACGAGAAGCAGATTTCATCAATGTAGTTGTAT
TCAGAAAACAAGCGAAGAATGTAAACGATTATCTTTCAAAAGGTTCACTAGCAGGTGTAGATGGACGTGTTCAATCACGT
AATTACGAAAATAACGAAGGTCGTCGAGTATTTGTTACAGAAGTTGTAGCTGATAGCGTTCAGTTCTTAGATACCAAAGG
TAATAACCAACAAAACAACCAACCTCAAAAGCAACAAGAACCAAGCGCAACTAAATATAATCCTTTTGCTAACGGTACAG
ACATGGATAGTTCAGAATTACCTTTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

76.415

74.648

0.57
  ssb Latilactobacillus sakei subsp. sakei 23K

47.059

100

0.563
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

74.648

0.444