Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   IRJ27_RS14870 Genome accession   NZ_CP064095
Coordinates   2918954..2919121 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain N1303-2Ay     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 2913954..2924121
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ27_RS14840 pncB 2914099..2915571 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  IRJ27_RS14845 pdeH 2915708..2916937 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  IRJ27_RS14850 - 2916913..2917281 (-) 369 WP_003243784.1 hypothetical protein -
  IRJ27_RS14855 - 2917395..2917520 (-) 126 WP_003228793.1 hypothetical protein -
  IRJ27_RS14860 degQ 2917742..2917882 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IRJ27_RS14865 comQ 2918067..2918966 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  IRJ27_RS14870 comX 2918954..2919121 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  IRJ27_RS14875 comP 2919136..2921444 (+) 2309 Protein_2888 two-component system sensor histidine kinase ComP -
  IRJ27_RS14880 comA 2921525..2922169 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IRJ27_RS14885 yuxO 2922188..2922568 (+) 381 WP_003228810.1 hotdog fold thioesterase -
  IRJ27_RS14890 mnhG 2922607..2922981 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  IRJ27_RS14895 mrpF 2922965..2923249 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  IRJ27_RS14900 mrpE 2923249..2923725 (-) 477 WP_003244015.1 Na+/H+ antiporter subunit E -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=499411 IRJ27_RS14870 WP_003242801.1 2918954..2919121(+) (comX) [Bacillus subtilis strain N1303-2Ay]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=499411 IRJ27_RS14870 WP_003242801.1 2918954..2919121(+) (comX) [Bacillus subtilis strain N1303-2Ay]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1