Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IRJ27_RS14860 Genome accession   NZ_CP064095
Coordinates   2917742..2917882 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain N1303-2Ay     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2912742..2922882
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ27_RS14830 yueI 2913037..2913435 (+) 399 WP_003242987.1 YueI family protein -
  IRJ27_RS14835 pncA 2913532..2914083 (+) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  IRJ27_RS14840 pncB 2914099..2915571 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  IRJ27_RS14845 pdeH 2915708..2916937 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  IRJ27_RS14850 - 2916913..2917281 (-) 369 WP_003243784.1 hypothetical protein -
  IRJ27_RS14855 - 2917395..2917520 (-) 126 WP_003228793.1 hypothetical protein -
  IRJ27_RS14860 degQ 2917742..2917882 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IRJ27_RS14865 comQ 2918067..2918966 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  IRJ27_RS14870 comX 2918954..2919121 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  IRJ27_RS14875 comP 2919136..2921444 (+) 2309 Protein_2888 two-component system sensor histidine kinase ComP -
  IRJ27_RS14880 comA 2921525..2922169 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IRJ27_RS14885 yuxO 2922188..2922568 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=499409 IRJ27_RS14860 WP_003220708.1 2917742..2917882(+) (degQ) [Bacillus subtilis strain N1303-2Ay]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=499409 IRJ27_RS14860 WP_003220708.1 2917742..2917882(+) (degQ) [Bacillus subtilis strain N1303-2Ay]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1