Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   IRJ26_RS12670 Genome accession   NZ_CP064094
Coordinates   2430106..2430273 (+) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain N1108-5at     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 2425106..2435273
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ26_RS12640 pncB 2425251..2426723 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  IRJ26_RS12645 pdeH 2426860..2428089 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  IRJ26_RS12650 - 2428065..2428433 (-) 369 WP_003243784.1 hypothetical protein -
  IRJ26_RS12655 - 2428547..2428672 (-) 126 WP_003228793.1 hypothetical protein -
  IRJ26_RS12660 degQ 2428894..2429034 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IRJ26_RS12665 comQ 2429219..2430118 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  IRJ26_RS12670 comX 2430106..2430273 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  IRJ26_RS12675 comP 2430288..2432596 (+) 2309 Protein_2445 two-component system sensor histidine kinase ComP -
  IRJ26_RS12680 comA 2432677..2433321 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IRJ26_RS12685 yuxO 2433340..2433720 (+) 381 WP_003228810.1 hotdog fold thioesterase -
  IRJ26_RS12690 mnhG 2433759..2434133 (-) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  IRJ26_RS12695 mrpF 2434117..2434401 (-) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  IRJ26_RS12700 mrpE 2434401..2434877 (-) 477 WP_003244015.1 Na+/H+ antiporter subunit E -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=499319 IRJ26_RS12670 WP_003242801.1 2430106..2430273(+) (comX) [Bacillus subtilis strain N1108-5at]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=499319 IRJ26_RS12670 WP_003242801.1 2430106..2430273(+) (comX) [Bacillus subtilis strain N1108-5at]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1