Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IRJ26_RS12660 Genome accession   NZ_CP064094
Coordinates   2428894..2429034 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain N1108-5at     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2423894..2434034
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IRJ26_RS12630 yueI 2424189..2424587 (+) 399 WP_003242987.1 YueI family protein -
  IRJ26_RS12635 pncA 2424684..2425235 (+) 552 WP_003243099.1 isochorismatase family cysteine hydrolase -
  IRJ26_RS12640 pncB 2425251..2426723 (+) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  IRJ26_RS12645 pdeH 2426860..2428089 (+) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  IRJ26_RS12650 - 2428065..2428433 (-) 369 WP_003243784.1 hypothetical protein -
  IRJ26_RS12655 - 2428547..2428672 (-) 126 WP_003228793.1 hypothetical protein -
  IRJ26_RS12660 degQ 2428894..2429034 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IRJ26_RS12665 comQ 2429219..2430118 (+) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  IRJ26_RS12670 comX 2430106..2430273 (+) 168 WP_003242801.1 competence pheromone ComX Regulator
  IRJ26_RS12675 comP 2430288..2432596 (+) 2309 Protein_2445 two-component system sensor histidine kinase ComP -
  IRJ26_RS12680 comA 2432677..2433321 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IRJ26_RS12685 yuxO 2433340..2433720 (+) 381 WP_003228810.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=499317 IRJ26_RS12660 WP_003220708.1 2428894..2429034(+) (degQ) [Bacillus subtilis strain N1108-5at]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=499317 IRJ26_RS12660 WP_003220708.1 2428894..2429034(+) (degQ) [Bacillus subtilis strain N1108-5at]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1