Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   SALIVA_RS04515 Genome accession   NC_017595
Coordinates   935004..935507 (+) Length   167 a.a.
NCBI ID   WP_014634360.1    Uniprot ID   -
Organism   Streptococcus salivarius JIM8777     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 923591..966338 935004..935507 within 0


Gene organization within MGE regions


Location: 923591..966338
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  SALIVA_RS04430 (SALIVA_0908) - 923591..924670 (-) 1080 WP_014634343.1 tyrosine-type recombinase/integrase -
  SALIVA_RS04435 (SALIVA_0909) - 924751..925209 (-) 459 WP_014634344.1 hypothetical protein -
  SALIVA_RS04440 (SALIVA_0910) - 925228..925614 (-) 387 WP_014634345.1 ImmA/IrrE family metallo-endopeptidase -
  SALIVA_RS04445 (SALIVA_0911) - 925604..925990 (-) 387 WP_014634346.1 helix-turn-helix domain-containing protein -
  SALIVA_RS04450 (SALIVA_0912) - 926159..926395 (+) 237 WP_014634347.1 DUF739 family protein -
  SALIVA_RS10560 - 926415..926579 (+) 165 WP_158308127.1 hypothetical protein -
  SALIVA_RS04455 (SALIVA_0913) - 926557..926760 (-) 204 WP_014634348.1 hypothetical protein -
  SALIVA_RS04460 (SALIVA_0914) - 926928..927116 (+) 189 WP_014634349.1 helix-turn-helix transcriptional regulator -
  SALIVA_RS04465 (SALIVA_0915) - 927113..927838 (+) 726 WP_014634350.1 phage antirepressor KilAC domain-containing protein -
  SALIVA_RS10705 - 927856..928095 (+) 240 WP_041826729.1 hypothetical protein -
  SALIVA_RS04475 (SALIVA_0916) - 928130..928438 (+) 309 WP_014634351.1 hypothetical protein -
  SALIVA_RS10605 (SALIVA_0917) - 928593..928748 (+) 156 WP_014634352.1 hypothetical protein -
  SALIVA_RS04480 (SALIVA_0918) - 928964..930712 (+) 1749 WP_014634353.1 SIALI-17 repeat-containing surface protein -
  SALIVA_RS04485 (SALIVA_0919) - 930715..931035 (+) 321 WP_014634354.1 hypothetical protein -
  SALIVA_RS04490 (SALIVA_0920) - 931153..931971 (+) 819 WP_014634355.1 DnaD domain-containing protein -
  SALIVA_RS04495 (SALIVA_0921) - 932061..932834 (+) 774 WP_014634356.1 ATP-binding protein -
  SALIVA_RS04500 (SALIVA_0922) - 932839..933021 (+) 183 WP_014634357.1 hypothetical protein -
  SALIVA_RS04505 (SALIVA_0923) bet 933157..933912 (+) 756 WP_014634358.1 phage recombination protein Bet -
  SALIVA_RS04510 (SALIVA_0924) - 933926..934936 (+) 1011 WP_014634359.1 DUF1351 domain-containing protein -
  SALIVA_RS04515 (SALIVA_0925) ssb 935004..935507 (+) 504 WP_014634360.1 single-stranded DNA-binding protein Machinery gene
  SALIVA_RS04520 (SALIVA_0926) - 935516..935977 (+) 462 WP_014634361.1 RusA family crossover junction endodeoxyribonuclease -
  SALIVA_RS04530 - 936363..936764 (+) 402 Protein_846 DNA cytosine methyltransferase -
  SALIVA_RS04535 (SALIVA_0929) - 936761..937048 (+) 288 WP_014634363.1 DUF1372 family protein -
  SALIVA_RS04540 (SALIVA_0930) - 937045..937422 (+) 378 WP_014634364.1 YopX family protein -
  SALIVA_RS04545 (SALIVA_0931) - 937413..938123 (+) 711 WP_041826665.1 DUF1340 domain-containing protein -
  SALIVA_RS04550 (SALIVA_0932) - 938453..938851 (+) 399 WP_014634366.1 DUF1492 domain-containing protein -
  SALIVA_RS04555 (SALIVA_2091) - 939115..939489 (+) 375 WP_231848738.1 HNH endonuclease -
  SALIVA_RS04560 (SALIVA_0933) - 939670..940128 (+) 459 WP_014634368.1 phage terminase small subunit P27 family -
  SALIVA_RS04565 (SALIVA_0934) - 940141..942018 (+) 1878 WP_014634369.1 terminase large subunit -
  SALIVA_RS04570 (SALIVA_0935) - 942022..942201 (+) 180 WP_014634370.1 DUF1056 family protein -
  SALIVA_RS04575 (SALIVA_0936) - 942219..943370 (+) 1152 WP_014634371.1 phage portal protein -
  SALIVA_RS04580 (SALIVA_0937) - 943357..944025 (+) 669 WP_014634372.1 head maturation protease, ClpP-related -
  SALIVA_RS04585 (SALIVA_0938) - 944040..945230 (+) 1191 WP_014634373.1 phage major capsid protein -
  SALIVA_RS04590 (SALIVA_0939) - 945246..945560 (+) 315 WP_014634374.1 head-tail connector protein -
  SALIVA_RS04595 (SALIVA_0940) - 945560..945910 (+) 351 WP_014634375.1 phage head closure protein -
  SALIVA_RS04600 (SALIVA_0941) - 945917..946339 (+) 423 WP_014634376.1 HK97 gp10 family phage protein -
  SALIVA_RS04605 (SALIVA_0942) - 946344..946715 (+) 372 WP_014634377.1 DUF806 family protein -
  SALIVA_RS04610 (SALIVA_0943) - 946734..947348 (+) 615 WP_014634378.1 phage tail protein -
  SALIVA_RS04615 (SALIVA_0944) - 947412..947765 (+) 354 WP_014634379.1 phage tail tube assembly chaperone -
  SALIVA_RS04620 (SALIVA_0946) - 947986..952950 (+) 4965 WP_014634381.1 tape measure protein -
  SALIVA_RS04625 (SALIVA_0947) - 952956..954512 (+) 1557 WP_014634382.1 distal tail protein Dit -
  SALIVA_RS10800 (SALIVA_0949) - 954512..958864 (+) 4353 WP_014634383.1 phage tail protein -
  SALIVA_RS04640 (SALIVA_0950) - 958866..960908 (+) 2043 WP_014634384.1 DUF859 family phage minor structural protein -
  SALIVA_RS04645 (SALIVA_0951) - 960925..961176 (+) 252 WP_014634385.1 hypothetical protein -
  SALIVA_RS04650 (SALIVA_0952) - 961209..961625 (+) 417 WP_014634386.1 hypothetical protein -
  SALIVA_RS04655 (SALIVA_0953) - 961628..961903 (+) 276 WP_014634387.1 phage holin -
  SALIVA_RS04660 (SALIVA_0954) - 961907..962359 (+) 453 WP_014634388.1 hypothetical protein -
  SALIVA_RS04665 (SALIVA_0955) - 962372..962698 (+) 327 WP_014634389.1 hypothetical protein -
  SALIVA_RS04670 (SALIVA_0956) - 962712..962984 (+) 273 WP_014634390.1 hypothetical protein -
  SALIVA_RS10340 (SALIVA_0957) - 963003..964388 (+) 1386 WP_014634391.1 GH25 family lysozyme -
  SALIVA_RS10220 (SALIVA_0958) - 964820..965074 (+) 255 WP_162470187.1 hypothetical protein -
  SALIVA_RS04690 (SALIVA_0959) - 965542..966087 (-) 546 WP_014634393.1 hypothetical protein -
  SALIVA_RS10345 (SALIVA_0960) - 966162..966338 (-) 177 WP_002883513.1 DUF3042 family protein -

Sequence

Protein


Download         Length: 167 a.a.        Molecular weight: 18354.10 Da        Isoelectric Point: 4.9007

>NTDB_id=49464 SALIVA_RS04515 WP_014634360.1 935004..935507(+) (ssb) [Streptococcus salivarius JIM8777]
MINSVCLVGRLTRDAELKYTGNNIAVATFSLAVNRNFKDANGERETDFINCVIWRQQAENLANWAKKGALIGITGRIQTR
SYENQQGQRVYVTEVVAENFQMLESRAAREGSNANQGNTSGAFSNDNGYAGPYGQQAPQQQGPNFARDSSSYGNSSPMDI
QDSDLPF

Nucleotide


Download         Length: 504 bp        

>NTDB_id=49464 SALIVA_RS04515 WP_014634360.1 935004..935507(+) (ssb) [Streptococcus salivarius JIM8777]
ATGATTAATTCAGTCTGTCTTGTTGGAAGATTAACAAGAGACGCAGAACTTAAATACACTGGAAATAACATTGCAGTAGC
TACGTTTAGCCTAGCTGTTAACCGCAACTTCAAAGATGCTAACGGCGAACGTGAAACAGACTTTATCAACTGCGTTATCT
GGCGCCAGCAAGCCGAGAATTTGGCTAACTGGGCTAAAAAAGGCGCATTGATTGGCATTACTGGACGCATTCAGACCCGT
AGCTATGAGAATCAGCAAGGTCAAAGAGTGTATGTGACTGAGGTAGTCGCTGAAAACTTCCAAATGTTGGAAAGCCGTGC
GGCGCGTGAAGGTAGTAACGCAAATCAAGGCAACACGTCTGGAGCGTTTAGCAATGACAACGGCTATGCAGGGCCTTACG
GGCAACAAGCACCGCAACAGCAAGGACCAAACTTTGCAAGGGATAGCAGCTCATACGGGAACAGTAGCCCTATGGATATC
CAAGATTCAGACCTACCCTTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

54.651

100

0.563
  ssbA Bacillus subtilis subsp. subtilis str. 168

53.448

100

0.557
  ssb Neisseria gonorrhoeae MS11

33.333

100

0.371

Multiple sequence alignment