Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | IMZ24_RS07480 | Genome accession | NZ_CP063157 |
| Coordinates | 1438905..1439078 (-) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain GY65 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1433905..1444078
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IMZ24_RS07430 (IMZ24_07430) | comGD | 1434024..1434461 (+) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| IMZ24_RS07435 (IMZ24_07435) | comGE | 1434445..1434759 (+) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| IMZ24_RS07440 (IMZ24_07440) | comGF | 1434668..1435168 (+) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| IMZ24_RS07445 (IMZ24_07445) | comGG | 1435169..1435546 (+) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| IMZ24_RS07450 (IMZ24_07450) | - | 1435603..1435782 (+) | 180 | WP_022552966.1 | YqzE family protein | - |
| IMZ24_RS07455 (IMZ24_07455) | - | 1435823..1436152 (-) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| IMZ24_RS07460 (IMZ24_07460) | tapA | 1436411..1437082 (+) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| IMZ24_RS07465 (IMZ24_07465) | sipW | 1437054..1437638 (+) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| IMZ24_RS07470 (IMZ24_07470) | tasA | 1437703..1438488 (+) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| IMZ24_RS07475 (IMZ24_07475) | sinR | 1438536..1438871 (-) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| IMZ24_RS07480 (IMZ24_07480) | sinI | 1438905..1439078 (-) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| IMZ24_RS07485 (IMZ24_07485) | - | 1439255..1440049 (-) | 795 | WP_007612541.1 | YqhG family protein | - |
| IMZ24_RS07490 (IMZ24_07490) | - | 1440071..1441741 (-) | 1671 | WP_032874031.1 | DEAD/DEAH box helicase | - |
| IMZ24_RS07495 (IMZ24_07495) | gcvT | 1442164..1443264 (+) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=493571 IMZ24_RS07480 WP_032874029.1 1438905..1439078(-) (sinI) [Bacillus velezensis strain GY65]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=493571 IMZ24_RS07480 WP_032874029.1 1438905..1439078(-) (sinI) [Bacillus velezensis strain GY65]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |