Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   IMZ24_RS07445 Genome accession   NZ_CP063157
Coordinates   1435169..1435546 (+) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain GY65     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1430169..1440546
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IMZ24_RS07410 (IMZ24_07410) - 1430480..1431430 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  IMZ24_RS07415 (IMZ24_07415) comGA 1431627..1432697 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  IMZ24_RS07420 (IMZ24_07420) comGB 1432684..1433721 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  IMZ24_RS07425 (IMZ24_07425) comGC 1433768..1434034 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  IMZ24_RS07430 (IMZ24_07430) comGD 1434024..1434461 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  IMZ24_RS07435 (IMZ24_07435) comGE 1434445..1434759 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  IMZ24_RS07440 (IMZ24_07440) comGF 1434668..1435168 (+) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  IMZ24_RS07445 (IMZ24_07445) comGG 1435169..1435546 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  IMZ24_RS07450 (IMZ24_07450) - 1435603..1435782 (+) 180 WP_022552966.1 YqzE family protein -
  IMZ24_RS07455 (IMZ24_07455) - 1435823..1436152 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  IMZ24_RS07460 (IMZ24_07460) tapA 1436411..1437082 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  IMZ24_RS07465 (IMZ24_07465) sipW 1437054..1437638 (+) 585 WP_032874025.1 signal peptidase I SipW -
  IMZ24_RS07470 (IMZ24_07470) tasA 1437703..1438488 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  IMZ24_RS07475 (IMZ24_07475) sinR 1438536..1438871 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IMZ24_RS07480 (IMZ24_07480) sinI 1438905..1439078 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  IMZ24_RS07485 (IMZ24_07485) - 1439255..1440049 (-) 795 WP_007612541.1 YqhG family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=493569 IMZ24_RS07445 WP_032874019.1 1435169..1435546(+) (comGG) [Bacillus velezensis strain GY65]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=493569 IMZ24_RS07445 WP_032874019.1 1435169..1435546(+) (comGG) [Bacillus velezensis strain GY65]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488