Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IMZ18_RS02280 Genome accession   NZ_CP063151
Coordinates   417091..417231 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis subsp. subtilis strain CMIN-4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 412091..422231
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IMZ18_RS02250 (IMZ18_02250) yueI 412387..412785 (+) 399 WP_014480710.1 YueI family protein -
  IMZ18_RS02255 (IMZ18_02255) pncA 412882..413433 (+) 552 WP_014480709.1 isochorismatase family cysteine hydrolase -
  IMZ18_RS02260 (IMZ18_02260) pncB 413449..414921 (+) 1473 WP_014480708.1 nicotinate phosphoribosyltransferase -
  IMZ18_RS02265 (IMZ18_02265) pdeH 415057..416286 (+) 1230 WP_014480707.1 cyclic di-GMP phosphodiesterase -
  IMZ18_RS02270 (IMZ18_02270) - 416262..416630 (-) 369 WP_014477834.1 hypothetical protein -
  IMZ18_RS02275 (IMZ18_02275) - 416744..416869 (-) 126 WP_003228793.1 hypothetical protein -
  IMZ18_RS02280 (IMZ18_02280) degQ 417091..417231 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  IMZ18_RS02285 (IMZ18_02285) - 417416..418279 (+) 864 WP_014480705.1 polyprenyl synthetase family protein -
  IMZ18_RS02290 (IMZ18_02290) comX 418281..418502 (+) 222 WP_014480704.1 competence pheromone ComX -
  IMZ18_RS02295 (IMZ18_02295) comP 418518..420830 (+) 2313 WP_014480703.1 sensor histidine kinase Regulator
  IMZ18_RS02300 (IMZ18_02300) comA 420911..421555 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  IMZ18_RS02305 (IMZ18_02305) yuxO 421574..421954 (+) 381 WP_017695528.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=493440 IMZ18_RS02280 WP_003220708.1 417091..417231(+) (degQ) [Bacillus subtilis subsp. subtilis strain CMIN-4]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=493440 IMZ18_RS02280 WP_003220708.1 417091..417231(+) (degQ) [Bacillus subtilis subsp. subtilis strain CMIN-4]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1