Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   IL989_RS14470 Genome accession   NZ_CP062984
Coordinates   2939878..2940018 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus amyloliquefaciens strain PP19 isolate PP19     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2934878..2945018
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IL989_RS14445 (IL989_14445) - 2935218..2935601 (-) 384 WP_071347697.1 hotdog fold thioesterase -
  IL989_RS14450 (IL989_14450) comA 2935623..2936267 (-) 645 WP_014472195.1 response regulator transcription factor Regulator
  IL989_RS14455 (IL989_14455) comP 2936348..2938639 (-) 2292 WP_088613350.1 histidine kinase Regulator
  IL989_RS14460 (IL989_14460) comX 2938651..2938815 (-) 165 WP_007613432.1 competence pheromone ComX -
  IL989_RS14465 (IL989_14465) - 2938815..2939726 (-) 912 WP_125123647.1 polyprenyl synthetase family protein -
  IL989_RS14470 (IL989_14470) degQ 2939878..2940018 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  IL989_RS14475 (IL989_14475) - 2940483..2940824 (+) 342 WP_045509476.1 hypothetical protein -
  IL989_RS14480 (IL989_14480) - 2940831..2942054 (-) 1224 WP_193350693.1 EAL and HDOD domain-containing protein -
  IL989_RS14485 (IL989_14485) - 2942184..2943650 (-) 1467 WP_125123168.1 nicotinate phosphoribosyltransferase -
  IL989_RS14490 (IL989_14490) - 2943668..2944219 (-) 552 WP_045509472.1 cysteine hydrolase family protein -
  IL989_RS14495 (IL989_14495) - 2944300..2944695 (-) 396 WP_193350695.1 YueI family protein -
  IL989_RS14500 (IL989_14500) - 2944761..2945009 (-) 249 WP_013353404.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=492274 IL989_RS14470 WP_013353398.1 2939878..2940018(-) (degQ) [Bacillus amyloliquefaciens strain PP19 isolate PP19]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=492274 IL989_RS14470 WP_013353398.1 2939878..2940018(-) (degQ) [Bacillus amyloliquefaciens strain PP19 isolate PP19]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913