Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   IL989_RS01915 Genome accession   NZ_CP062984
Coordinates   380972..381091 (+) Length   39 a.a.
NCBI ID   WP_013351005.1    Uniprot ID   A0AAP7N4M9
Organism   Bacillus amyloliquefaciens strain PP19 isolate PP19     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 375972..386091
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IL989_RS01900 (IL989_01900) - 377582..378265 (+) 684 WP_193351292.1 response regulator transcription factor -
  IL989_RS01905 (IL989_01905) - 378252..379679 (+) 1428 WP_193351293.1 HAMP domain-containing sensor histidine kinase -
  IL989_RS01910 (IL989_01910) rapC 379840..380988 (+) 1149 WP_013351004.1 tetratricopeptide repeat protein Regulator
  IL989_RS01915 (IL989_01915) phrC 380972..381091 (+) 120 WP_013351005.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  IL989_RS01920 (IL989_01920) - 381239..381340 (-) 102 WP_013351006.1 YjcZ family sporulation protein -
  IL989_RS01925 (IL989_01925) - 381435..382799 (-) 1365 WP_013351007.1 aspartate kinase -
  IL989_RS01930 (IL989_01930) ceuB 383214..384167 (+) 954 WP_193351294.1 ABC transporter permease Machinery gene
  IL989_RS01935 (IL989_01935) - 384157..385104 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  IL989_RS01940 (IL989_01940) - 385098..385856 (+) 759 WP_013351009.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=492222 IL989_RS01915 WP_013351005.1 380972..381091(+) (phrC) [Bacillus amyloliquefaciens strain PP19 isolate PP19]
MKLKSKWFVICLAAAAIFTAAGVSQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=492222 IL989_RS01915 WP_013351005.1 380972..381091(+) (phrC) [Bacillus amyloliquefaciens strain PP19 isolate PP19]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGCTGCAGGTGTAAGCCAGACAGA
TCAGGCTGAATTCCATGTGGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

80

100

0.821