Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   LMOG_RS13535 Genome accession   NC_017545
Coordinates   2706337..2706819 (-) Length   160 a.a.
NCBI ID   WP_003723952.1    Uniprot ID   A0A823F2G5
Organism   Listeria monocytogenes J0161     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2682416..2721202 2706337..2706819 within 0


Gene organization within MGE regions


Location: 2682416..2721202
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LMOG_RS13390 (LMOG_02993) acrIIA4 2682416..2682679 (+) 264 WP_003723290.1 anti-CRISPR protein AcrIIA4 -
  LMOG_RS13395 (LMOG_02992) acrIIA1 2682684..2683133 (+) 450 WP_003723291.1 anti-CRISPR protein AcrIIA1 -
  LMOG_RS13400 (LMOG_02991) - 2683207..2683806 (-) 600 WP_003723292.1 N-acetyltransferase -
  LMOG_RS15560 (LMOG_02990) - 2683793..2683969 (-) 177 WP_003733956.1 hypothetical protein -
  LMOG_RS13405 (LMOG_02989) - 2684208..2684915 (-) 708 WP_003723293.1 M15 family metallopeptidase -
  LMOG_RS13410 (LMOG_02988) - 2684915..2685196 (-) 282 WP_003723294.1 phage holin -
  LMOG_RS13415 (LMOG_02987) - 2685196..2685501 (-) 306 WP_003733957.1 hypothetical protein -
  LMOG_RS13420 (LMOG_02986) - 2685552..2687714 (-) 2163 WP_003723296.1 phage tail spike protein -
  LMOG_RS13425 (LMOG_02985) - 2687727..2689295 (-) 1569 WP_003734108.1 distal tail protein Dit -
  LMOG_RS13430 (LMOG_02984) - 2689292..2694082 (-) 4791 WP_003733958.1 phage tail tape measure protein -
  LMOG_RS15680 (LMOG_02983) - 2694087..2694398 (-) 312 WP_077904865.1 Gp15 family bacteriophage protein -
  LMOG_RS13440 (LMOG_02982) - 2694395..2694826 (-) 432 WP_003723780.1 hypothetical protein -
  LMOG_RS13445 - 2694875..2695180 (-) 306 WP_226319503.1 Ig-like domain-containing protein -
  LMOG_RS13450 - 2695137..2695568 (-) 432 WP_003723782.1 phage tail tube protein -
  LMOG_RS13455 (LMOG_02979) - 2695540..2695944 (-) 405 WP_003723783.1 hypothetical protein -
  LMOG_RS13460 (LMOG_02978) - 2695941..2696258 (-) 318 WP_003723784.1 HK97 gp10 family phage protein -
  LMOG_RS13465 (LMOG_02977) - 2696248..2696613 (-) 366 WP_003733959.1 hypothetical protein -
  LMOG_RS13470 (LMOG_02976) - 2696613..2696966 (-) 354 WP_003723785.1 hypothetical protein -
  LMOG_RS15565 (LMOG_02975) - 2696967..2697122 (-) 156 WP_003723786.1 hypothetical protein -
  LMOG_RS13475 (LMOG_02974) - 2697136..2698008 (-) 873 WP_003723787.1 hypothetical protein -
  LMOG_RS13480 (LMOG_02973) - 2698031..2698585 (-) 555 WP_003723788.1 hypothetical protein -
  LMOG_RS13485 (LMOG_02972) - 2698681..2699724 (-) 1044 WP_003723789.1 phage minor capsid protein -
  LMOG_RS13490 (LMOG_02971) - 2699729..2701285 (-) 1557 WP_003723790.1 hypothetical protein -
  LMOG_RS13495 (LMOG_02970) - 2701300..2702619 (-) 1320 WP_003733960.1 PBSX family phage terminase large subunit -
  LMOG_RS13500 (LMOG_02969) terS 2702558..2703343 (-) 786 WP_003723792.1 phage terminase small subunit -
  LMOG_RS13505 (LMOG_02968) - 2703383..2703610 (-) 228 WP_003723793.1 hypothetical protein -
  LMOG_RS13510 (LMOG_02967) - 2704156..2704758 (-) 603 WP_003723794.1 hypothetical protein -
  LMOG_RS13515 (LMOG_02966) - 2704785..2705222 (-) 438 WP_003723795.1 ArpU family phage packaging/lysis transcriptional regulator -
  LMOG_RS15670 - 2705244..2705369 (-) 126 WP_256094150.1 hypothetical protein -
  LMOG_RS13520 (LMOG_02965) - 2705388..2705774 (-) 387 WP_003723796.1 DUF2481 family protein -
  LMOG_RS13525 (LMOG_02964) - 2705778..2706182 (-) 405 WP_003733961.1 DUF1064 domain-containing protein -
  LMOG_RS13530 (LMOG_02963) - 2706127..2706318 (-) 192 WP_003723797.1 hypothetical protein -
  LMOG_RS13535 (LMOG_02962) ssbA 2706337..2706819 (-) 483 WP_003723952.1 single-stranded DNA-binding protein Machinery gene
  LMOG_RS13540 (LMOG_02961) - 2706816..2707316 (-) 501 WP_003723953.1 hypothetical protein -
  LMOG_RS13545 (LMOG_02960) - 2707313..2707714 (-) 402 WP_003723954.1 hypothetical protein -
  LMOG_RS13550 (LMOG_02959) - 2707711..2707971 (-) 261 WP_003723955.1 hypothetical protein -
  LMOG_RS13555 (LMOG_02958) - 2707971..2708177 (-) 207 WP_003723956.1 hypothetical protein -
  LMOG_RS13560 (LMOG_02957) - 2708174..2708659 (-) 486 WP_003723957.1 pentapeptide repeat-containing protein -
  LMOG_RS13565 (LMOG_02956) - 2708656..2708865 (-) 210 WP_003723958.1 hypothetical protein -
  LMOG_RS13570 (LMOG_02955) - 2708862..2709269 (-) 408 WP_003723959.1 YopX family protein -
  LMOG_RS13575 (LMOG_02954) - 2709266..2709454 (-) 189 WP_003733963.1 hypothetical protein -
  LMOG_RS13580 (LMOG_02953) - 2709447..2710049 (-) 603 WP_003723960.1 DUF1642 domain-containing protein -
  LMOG_RS13585 (LMOG_02952) - 2710046..2710255 (-) 210 WP_003723961.1 hypothetical protein -
  LMOG_RS15685 (LMOG_02951) - 2710252..2710545 (-) 294 WP_003723969.1 hypothetical protein -
  LMOG_RS13595 (LMOG_02950) - 2710562..2710759 (-) 198 WP_003723963.1 hypothetical protein -
  LMOG_RS13600 (LMOG_02949) - 2710763..2711668 (-) 906 WP_003723964.1 DnaD domain-containing protein -
  LMOG_RS13605 (LMOG_02948) - 2711706..2712617 (-) 912 WP_003723965.1 RecT family recombinase -
  LMOG_RS13610 (LMOG_02947) - 2712610..2714121 (-) 1512 WP_003723967.1 AAA family ATPase -
  LMOG_RS13615 (LMOG_02946) - 2714354..2714542 (-) 189 WP_003722564.1 gp45 family putative tail fiber system protein -
  LMOG_RS13620 (LMOG_02945) - 2714645..2714851 (-) 207 WP_003733681.1 helix-turn-helix transcriptional regulator -
  LMOG_RS13625 (LMOG_02944) - 2714841..2715371 (-) 531 WP_003733682.1 hypothetical protein -
  LMOG_RS13630 (LMOG_02943) - 2715495..2716271 (-) 777 WP_003733683.1 phage antirepressor Ant -
  LMOG_RS15570 - 2716335..2716532 (+) 198 WP_003733684.1 hypothetical protein -
  LMOG_RS13640 (LMOG_02940) - 2716534..2716815 (-) 282 WP_003722567.1 hypothetical protein -
  LMOG_RS13645 (LMOG_02939) - 2716841..2717125 (-) 285 WP_003733686.1 hypothetical protein -
  LMOG_RS13650 (LMOG_02938) - 2717137..2717331 (-) 195 WP_003733687.1 hypothetical protein -
  LMOG_RS13655 (LMOG_02937) - 2717352..2717561 (-) 210 WP_003733688.1 helix-turn-helix transcriptional regulator -
  LMOG_RS13660 (LMOG_02936) - 2717727..2718149 (+) 423 WP_003724014.1 helix-turn-helix transcriptional regulator -
  LMOG_RS13665 (LMOG_02935) - 2718165..2718590 (+) 426 WP_003724015.1 ImmA/IrrE family metallo-endopeptidase -
  LMOG_RS13670 (LMOG_02934) - 2718605..2719312 (+) 708 WP_003724016.1 hypothetical protein -
  LMOG_RS13675 (LMOG_02933) - 2719371..2719976 (+) 606 WP_003724017.1 hypothetical protein -
  LMOG_RS13680 (LMOG_02932) - 2720039..2721202 (+) 1164 WP_003724018.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 160 a.a.        Molecular weight: 17837.65 Da        Isoelectric Point: 4.9909

>NTDB_id=48495 LMOG_RS13535 WP_003723952.1 2706337..2706819(-) (ssbA) [Listeria monocytogenes J0161]
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQQGEREADFINCVVWRKPAENVANFLKKGSMAGVDGRVQTR
NYEDSDGKRVFVTEVVAESVQFLDPKNNNVEGTTSNNYQNKANYSNNNKTSSYRADTGQNSDSFANEGKPIDINEDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=48495 LMOG_RS13535 WP_003723952.1 2706337..2706819(-) (ssbA) [Listeria monocytogenes J0161]
ATGATGAACCGTGTAGTACTTGTAGGACGATTAACAAAAGACCCTGAATTACGTTACACTCCAGCAGGCGTGGCTGTTGC
GACTTTTACTTTAGCTGTAAATCGTACGTTCACTAACCAACAGGGAGAGCGAGAAGCTGACTTTATTAATTGTGTTGTTT
GGCGTAAACCAGCAGAAAACGTTGCTAATTTCCTTAAGAAGGGAAGCATGGCAGGTGTTGATGGACGTGTTCAAACTCGT
AATTATGAGGATAGCGACGGTAAACGCGTTTTCGTTACAGAAGTAGTTGCTGAATCAGTTCAATTCTTAGACCCTAAAAA
TAACAACGTAGAAGGCACTACATCGAATAATTATCAAAACAAGGCTAATTATTCAAATAACAATAAAACAAGCTCATATA
GAGCGGATACGGGCCAGAATAGTGATTCATTTGCGAATGAAGGTAAGCCGATTGATATTAACGAAGACGATTTGCCGTTT
TGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A823F2G5

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.698

100

0.706

  ssb Latilactobacillus sakei subsp. sakei 23K

52.941

100

0.562

  ssbB Bacillus subtilis subsp. subtilis str. 168

63.208

66.25

0.419


Multiple sequence alignment