Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   ID168_RS11520 Genome accession   NZ_CP061704
Coordinates   2417091..2417264 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Y4_39     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2412091..2422264
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ID168_RS11505 (ID168_11505) gcvT 2412908..2414008 (-) 1101 WP_094247736.1 glycine cleavage system aminomethyltransferase GcvT -
  ID168_RS11510 (ID168_11510) - 2414432..2416102 (+) 1671 WP_069013074.1 DEAD/DEAH box helicase -
  ID168_RS11515 (ID168_11515) - 2416120..2416914 (+) 795 WP_014305407.1 YqhG family protein -
  ID168_RS11520 (ID168_11520) sinI 2417091..2417264 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ID168_RS11525 (ID168_11525) sinR 2417298..2417633 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ID168_RS11530 (ID168_11530) tasA 2417681..2418466 (-) 786 WP_094247735.1 biofilm matrix protein TasA -
  ID168_RS11535 (ID168_11535) sipW 2418530..2419114 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ID168_RS11540 (ID168_11540) tapA 2419086..2419757 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  ID168_RS11545 (ID168_11545) - 2420016..2420345 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ID168_RS11550 (ID168_11550) - 2420385..2420564 (-) 180 WP_003153093.1 YqzE family protein -
  ID168_RS11555 (ID168_11555) comGG 2420621..2420998 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  ID168_RS11560 (ID168_11560) comGF 2420999..2421394 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  ID168_RS11565 (ID168_11565) comGE 2421408..2421722 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ID168_RS11570 (ID168_11570) comGD 2421706..2422143 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=484296 ID168_RS11520 WP_003153105.1 2417091..2417264(+) (sinI) [Bacillus velezensis strain Y4_39]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=484296 ID168_RS11520 WP_003153105.1 2417091..2417264(+) (sinI) [Bacillus velezensis strain Y4_39]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702