Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | ID168_RS11520 | Genome accession | NZ_CP061704 |
| Coordinates | 2417091..2417264 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis strain Y4_39 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2412091..2422264
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ID168_RS11505 (ID168_11505) | gcvT | 2412908..2414008 (-) | 1101 | WP_094247736.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| ID168_RS11510 (ID168_11510) | - | 2414432..2416102 (+) | 1671 | WP_069013074.1 | DEAD/DEAH box helicase | - |
| ID168_RS11515 (ID168_11515) | - | 2416120..2416914 (+) | 795 | WP_014305407.1 | YqhG family protein | - |
| ID168_RS11520 (ID168_11520) | sinI | 2417091..2417264 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| ID168_RS11525 (ID168_11525) | sinR | 2417298..2417633 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| ID168_RS11530 (ID168_11530) | tasA | 2417681..2418466 (-) | 786 | WP_094247735.1 | biofilm matrix protein TasA | - |
| ID168_RS11535 (ID168_11535) | sipW | 2418530..2419114 (-) | 585 | WP_012117977.1 | signal peptidase I SipW | - |
| ID168_RS11540 (ID168_11540) | tapA | 2419086..2419757 (-) | 672 | WP_070082109.1 | amyloid fiber anchoring/assembly protein TapA | - |
| ID168_RS11545 (ID168_11545) | - | 2420016..2420345 (+) | 330 | WP_003153097.1 | DUF3889 domain-containing protein | - |
| ID168_RS11550 (ID168_11550) | - | 2420385..2420564 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| ID168_RS11555 (ID168_11555) | comGG | 2420621..2420998 (-) | 378 | WP_094247734.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| ID168_RS11560 (ID168_11560) | comGF | 2420999..2421394 (-) | 396 | WP_094247733.1 | competence type IV pilus minor pilin ComGF | - |
| ID168_RS11565 (ID168_11565) | comGE | 2421408..2421722 (-) | 315 | WP_015388003.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| ID168_RS11570 (ID168_11570) | comGD | 2421706..2422143 (-) | 438 | WP_025852922.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=484296 ID168_RS11520 WP_003153105.1 2417091..2417264(+) (sinI) [Bacillus velezensis strain Y4_39]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=484296 ID168_RS11520 WP_003153105.1 2417091..2417264(+) (sinI) [Bacillus velezensis strain Y4_39]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |