Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   ID168_RS11565 Genome accession   NZ_CP061704
Coordinates   2421408..2421722 (-) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain Y4_39     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2416408..2426722
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ID168_RS11520 (ID168_11520) sinI 2417091..2417264 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  ID168_RS11525 (ID168_11525) sinR 2417298..2417633 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  ID168_RS11530 (ID168_11530) tasA 2417681..2418466 (-) 786 WP_094247735.1 biofilm matrix protein TasA -
  ID168_RS11535 (ID168_11535) sipW 2418530..2419114 (-) 585 WP_012117977.1 signal peptidase I SipW -
  ID168_RS11540 (ID168_11540) tapA 2419086..2419757 (-) 672 WP_070082109.1 amyloid fiber anchoring/assembly protein TapA -
  ID168_RS11545 (ID168_11545) - 2420016..2420345 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  ID168_RS11550 (ID168_11550) - 2420385..2420564 (-) 180 WP_003153093.1 YqzE family protein -
  ID168_RS11555 (ID168_11555) comGG 2420621..2420998 (-) 378 WP_094247734.1 competence type IV pilus minor pilin ComGG Machinery gene
  ID168_RS11560 (ID168_11560) comGF 2420999..2421394 (-) 396 WP_094247733.1 competence type IV pilus minor pilin ComGF -
  ID168_RS11565 (ID168_11565) comGE 2421408..2421722 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  ID168_RS11570 (ID168_11570) comGD 2421706..2422143 (-) 438 WP_025852922.1 competence type IV pilus minor pilin ComGD Machinery gene
  ID168_RS11575 (ID168_11575) comGC 2422133..2422441 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  ID168_RS11580 (ID168_11580) comGB 2422446..2423483 (-) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  ID168_RS11585 (ID168_11585) comGA 2423470..2424540 (-) 1071 WP_070082113.1 competence type IV pilus ATPase ComGA Machinery gene
  ID168_RS11590 (ID168_11590) - 2424732..2425682 (-) 951 WP_071391609.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=484299 ID168_RS11565 WP_015388003.1 2421408..2421722(-) (comGE) [Bacillus velezensis strain Y4_39]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=484299 ID168_RS11565 WP_015388003.1 2421408..2421722(-) (comGE) [Bacillus velezensis strain Y4_39]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481