Detailed information NTG0483339

Bioinformatically predicted

Overview

• Name: comGG
• Type: Machinery gene
• Locus tag: J7U24_RS09055
• Genome accession: NZ_CP072440
• Coordinates: 1732937..1733254 (-)
• Length: 105 a.a.
• NCBI ID: WP_011681685.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain S24730
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1727937..1738254

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7U24_RS09020 (J7U24_08995)	-	1728296..1728958 (-)	663	WP_014727719.1	CPBP family intramembrane glutamic endopeptidase	-
J7U24_RS09025 (J7U24_09000)	-	1729055..1729498 (-)	444	WP_041829335.1	hypothetical protein	-
J7U24_RS09030	-	1729572..1729910 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
J7U24_RS09035	-	1729954..1730229 (-)	276	WP_372434690.1	CAAX protease	-
J7U24_RS09040 (J7U24_09010)	-	1730241..1730438 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
J7U24_RS09045 (J7U24_09015)	-	1730687..1731880 (-)	1194	WP_014608740.1	acetate kinase	-
J7U24_RS09050 (J7U24_09020)	comGH	1731936..1732892 (-)	957	WP_372434691.1	class I SAM-dependent methyltransferase	Machinery gene
J7U24_RS09055 (J7U24_09025)	comGG	1732937..1733254 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	Machinery gene
J7U24_RS09060 (J7U24_09030)	comGF	1733232..1733669 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7U24_RS09065 (J7U24_09035)	comGE	1733653..1733946 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	Machinery gene
J7U24_RS09070 (J7U24_09040)	comGD	1733918..1734346 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7U24_RS09075 (J7U24_09045)	comGC	1734306..1734632 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7U24_RS09080 (J7U24_09050)	comGB	1734629..1735729 (-)	1101	WP_142350125.1	competence type IV pilus assembly protein ComGB	Machinery gene
J7U24_RS09085 (J7U24_09055)	comGA/cglA/cilD	1735611..1736552 (-)	942	WP_071417491.1	competence type IV pilus ATPase ComGA	Machinery gene
J7U24_RS09090 (J7U24_09060)	-	1736633..1736995 (-)	363	WP_014622006.1	DUF1033 family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11851.01 Da
• Isoelectric Point: 10.6334

>NTDB_id=483339 J7U24_RS09055 WP_011681685.1 1732937..1733254(-) (comGG) [Streptococcus thermophilus strain S24730]
MLLKKQVRGGVLLYALFMAGIFILLLQVYLERVVASSRQNQAQIVASQSRLMAEMTMDLVDKEAGAFSFSQGTTTYEVKG
KQVVVRVVSKGQIKTYRYVKKQDQK

Nucleotide

• Length: 318 bp

>NTDB_id=483339 J7U24_RS09055 WP_011681685.1 1732937..1733254(-) (comGG) [Streptococcus thermophilus strain S24730]
ATGCTTTTGAAAAAACAGGTTAGGGGAGGCGTTCTTCTCTACGCTCTTTTTATGGCTGGCATTTTTATACTCCTTCTTCA
GGTTTATCTGGAACGGGTGGTAGCTAGCTCTAGACAAAACCAAGCGCAAATAGTGGCCAGTCAAAGCCGTCTCATGGCAG
AGATGACTATGGACTTGGTGGATAAGGAAGCAGGTGCTTTTAGTTTTTCTCAGGGGACTACGACTTACGAGGTTAAGGGT
AAGCAAGTGGTTGTCAGAGTTGTCAGTAAAGGCCAAATCAAGACCTATCGTTATGTGAAGAAACAAGATCAGAAATAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGG	Streptococcus mutans UA140	45.455	94.286	0.429
comGG	Streptococcus mutans UA159	45.455	94.286	0.429
comGG/cglG	Streptococcus pneumoniae Rx1	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae TIGR4	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae D39	43.333	85.714	0.371
comGG/cglG	Streptococcus pneumoniae R6	43.333	85.714	0.371
comGG/cglG	Streptococcus mitis NCTC 12261	42.222	85.714	0.362