Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   ICJ61_RS12905 Genome accession   NZ_CP061284
Coordinates   2501181..2501600 (-) Length   139 a.a.
NCBI ID   WP_316961080.1    Uniprot ID   -
Organism   Bacillus halotolerans strain XH-1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2496181..2506600
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ICJ61_RS12865 (ICJ61_12865) sinI 2497122..2497298 (+) 177 WP_188323132.1 anti-repressor SinI Regulator
  ICJ61_RS12870 (ICJ61_12870) sinR 2497332..2497667 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  ICJ61_RS12875 (ICJ61_12875) tasA 2497754..2498539 (-) 786 WP_106020091.1 biofilm matrix protein TasA -
  ICJ61_RS12880 (ICJ61_12880) sipW 2498604..2499188 (-) 585 WP_105955579.1 signal peptidase I SipW -
  ICJ61_RS12885 (ICJ61_12885) tapA 2499160..2499921 (-) 762 WP_106020093.1 amyloid fiber anchoring/assembly protein TapA -
  ICJ61_RS12890 (ICJ61_12890) - 2500189..2500512 (+) 324 WP_101864527.1 YqzG/YhdC family protein -
  ICJ61_RS12895 (ICJ61_12895) - 2500555..2500734 (-) 180 WP_003236949.1 YqzE family protein -
  ICJ61_RS12900 (ICJ61_12900) comGG 2500806..2501180 (-) 375 WP_188323133.1 competence type IV pilus minor pilin ComGG Machinery gene
  ICJ61_RS12905 (ICJ61_12905) comGF 2501181..2501600 (-) 420 WP_316961080.1 competence type IV pilus minor pilin ComGF Machinery gene
  ICJ61_RS12910 (ICJ61_12910) comGE 2501590..2501937 (-) 348 WP_151175142.1 competence type IV pilus minor pilin ComGE Machinery gene
  ICJ61_RS12915 (ICJ61_12915) comGD 2501921..2502352 (-) 432 WP_151175143.1 competence type IV pilus minor pilin ComGD Machinery gene
  ICJ61_RS12920 (ICJ61_12920) comGC 2502342..2502638 (-) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  ICJ61_RS12925 (ICJ61_12925) comGB 2502652..2503689 (-) 1038 WP_151175144.1 competence type IV pilus assembly protein ComGB Machinery gene
  ICJ61_RS12930 (ICJ61_12930) comGA 2503676..2504746 (-) 1071 WP_095713275.1 competence protein ComGA Machinery gene
  ICJ61_RS12935 (ICJ61_12935) - 2505067..2505477 (-) 411 WP_106020097.1 CBS domain-containing protein -
  ICJ61_RS12940 (ICJ61_12940) - 2505540..2506493 (-) 954 WP_095713277.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 139 a.a.        Molecular weight: 15922.41 Da        Isoelectric Point: 7.9233

>NTDB_id=481529 ICJ61_RS12905 WP_316961080.1 2501181..2501600(-) (comGF) [Bacillus halotolerans strain XH-1]
MLLNVLFSLSAYLLISGSLAIFFHLFLSRQQENEGFMQREWVISVEQIMNECKQSQTVQTDEHGSVLICRNLSGQEVRFE
IYHSMIRKRVDGKGHVPILDHIKTMKAGVKNGMLWLKVKNENDKEYQTAFPVYTSLGGG

Nucleotide


Download         Length: 420 bp        

>NTDB_id=481529 ICJ61_RS12905 WP_316961080.1 2501181..2501600(-) (comGF) [Bacillus halotolerans strain XH-1]
ATGCTTCTTAATGTATTATTTTCGCTCTCTGCTTATTTGCTCATATCAGGATCGTTAGCGATATTCTTTCATCTATTTTT
GTCACGTCAACAGGAGAATGAGGGCTTCATGCAGCGGGAATGGGTCATTTCGGTAGAGCAGATCATGAATGAGTGCAAGC
AGTCGCAGACAGTGCAGACAGATGAGCATGGCAGCGTCTTAATCTGCAGAAATCTGTCAGGGCAAGAGGTCCGTTTTGAA
ATCTACCATTCAATGATCAGAAAAAGAGTAGACGGAAAAGGGCATGTTCCGATTCTTGATCATATTAAAACAATGAAAGC
CGGGGTTAAAAACGGGATGCTTTGGCTGAAAGTCAAGAATGAGAATGATAAAGAGTATCAAACCGCTTTTCCGGTATATA
CGTCGTTAGGAGGTGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

72.441

91.367

0.662