Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   JS609_RS12270 Genome accession   NZ_CP071043
Coordinates   2402745..2403128 (-) Length   127 a.a.
NCBI ID   WP_029726721.1    Uniprot ID   -
Organism   Bacillus subtilis isolate ELA2001105     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2397745..2408128
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JS609_RS12230 (JS609_02411) sinI 2398679..2398852 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  JS609_RS12235 (JS609_02412) sinR 2398886..2399221 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JS609_RS12240 (JS609_02413) tasA 2399314..2400099 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  JS609_RS12245 (JS609_02414) sipW 2400163..2400735 (-) 573 WP_003230181.1 signal peptidase I SipW -
  JS609_RS12250 (JS609_02415) tapA 2400719..2401480 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  JS609_RS12255 (JS609_02416) yqzG 2401752..2402078 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  JS609_RS12260 (JS609_02417) spoIITA 2402120..2402299 (-) 180 WP_213414620.1 YqzE family protein -
  JS609_RS12265 (JS609_02418) comGG 2402370..2402744 (-) 375 WP_225722048.1 ComG operon protein ComGG Machinery gene
  JS609_RS12270 (JS609_02419) comGF 2402745..2403128 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  JS609_RS12275 (JS609_02420) comGE 2403154..2403501 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  JS609_RS12280 (JS609_02421) comGD 2403485..2403916 (-) 432 WP_029726720.1 comG operon protein ComGD Machinery gene
  JS609_RS12285 (JS609_02422) comGC 2403906..2404202 (-) 297 WP_029726719.1 comG operon protein ComGC Machinery gene
  JS609_RS12290 (JS609_02423) comGB 2404216..2405253 (-) 1038 WP_029726718.1 comG operon protein ComGB Machinery gene
  JS609_RS12295 (JS609_02424) comGA 2405240..2406310 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  JS609_RS12300 (JS609_02426) - 2406523..2406720 (-) 198 WP_029726717.1 hypothetical protein -
  JS609_RS12305 (JS609_02427) corA 2406722..2407675 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14409.52 Da        Isoelectric Point: 5.8940

>NTDB_id=475845 JS609_RS12270 WP_029726721.1 2402745..2403128(-) (comGF) [Bacillus subtilis isolate ELA2001105]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADFENCVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=475845 JS609_RS12270 WP_029726721.1 2402745..2403128(-) (comGF) [Bacillus subtilis isolate ELA2001105]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATTTTGAAAATTGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969