Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   JS609_RS12230 Genome accession   NZ_CP071043
Coordinates   2398679..2398852 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis isolate ELA2001105     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2393679..2403852
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JS609_RS12215 (JS609_02408) gcvT 2394479..2395567 (-) 1089 WP_080529534.1 glycine cleavage system aminomethyltransferase GcvT -
  JS609_RS12220 (JS609_02409) hepAA 2396008..2397681 (+) 1674 WP_003230203.1 DEAD/DEAH box helicase -
  JS609_RS12225 (JS609_02410) yqhG 2397702..2398496 (+) 795 WP_003230200.1 YqhG family protein -
  JS609_RS12230 (JS609_02411) sinI 2398679..2398852 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  JS609_RS12235 (JS609_02412) sinR 2398886..2399221 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JS609_RS12240 (JS609_02413) tasA 2399314..2400099 (-) 786 WP_003230183.1 biofilm matrix protein TasA -
  JS609_RS12245 (JS609_02414) sipW 2400163..2400735 (-) 573 WP_003230181.1 signal peptidase I SipW -
  JS609_RS12250 (JS609_02415) tapA 2400719..2401480 (-) 762 WP_029726724.1 amyloid fiber anchoring/assembly protein TapA -
  JS609_RS12255 (JS609_02416) yqzG 2401752..2402078 (+) 327 WP_029317915.1 YqzG/YhdC family protein -
  JS609_RS12260 (JS609_02417) spoIITA 2402120..2402299 (-) 180 WP_213414620.1 YqzE family protein -
  JS609_RS12265 (JS609_02418) comGG 2402370..2402744 (-) 375 WP_225722048.1 ComG operon protein ComGG Machinery gene
  JS609_RS12270 (JS609_02419) comGF 2402745..2403128 (-) 384 WP_029726721.1 ComG operon protein ComGF Machinery gene
  JS609_RS12275 (JS609_02420) comGE 2403154..2403501 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=475842 JS609_RS12230 WP_003230187.1 2398679..2398852(+) (sinI) [Bacillus subtilis isolate ELA2001105]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=475842 JS609_RS12230 WP_003230187.1 2398679..2398852(+) (sinI) [Bacillus subtilis isolate ELA2001105]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1