Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   H7992_RS09300 Genome accession   NZ_CP060287
Coordinates   1860097..1860573 (+) Length   158 a.a.
NCBI ID   WP_187047842.1    Uniprot ID   A0A7G8XD32
Organism   Sporosarcina sp. resist     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1852438..1896388 1860097..1860573 within 0


Gene organization within MGE regions


Location: 1852438..1896388
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H7992_RS09260 (H7992_09260) - 1852438..1852932 (+) 495 WP_187047347.1 metallophosphoesterase -
  H7992_RS09270 (H7992_09270) - 1853237..1854340 (-) 1104 WP_370569983.1 tyrosine-type recombinase/integrase -
  H7992_RS25040 (H7992_09275) - 1854363..1854629 (-) 267 WP_370569984.1 ImmA/IrrE family metallo-endopeptidase -
  H7992_RS09280 (H7992_09280) - 1854633..1855169 (+) 537 WP_187047348.1 DUF4238 domain-containing protein -
  H7992_RS09285 (H7992_09285) - 1856084..1857352 (+) 1269 WP_187047349.1 Cthe_2314 family HEPN domain-containing protein -
  H7992_RS09290 (H7992_09290) - 1857959..1859239 (+) 1281 WP_187047350.1 RecT family recombinase -
  H7992_RS09295 (H7992_09295) - 1859242..1860027 (+) 786 WP_187047351.1 hypothetical protein -
  H7992_RS09300 (H7992_09300) ssbA 1860097..1860573 (+) 477 WP_187047842.1 single-stranded DNA-binding protein Machinery gene
  H7992_RS09305 (H7992_09305) - 1860587..1861198 (+) 612 WP_187047352.1 DUF6036 family nucleotidyltransferase -
  H7992_RS09310 (H7992_09310) - 1861245..1861610 (+) 366 WP_187047353.1 hypothetical protein -
  H7992_RS09315 (H7992_09315) - 1861694..1862398 (+) 705 WP_187047354.1 PD-(D/E)XK nuclease family protein -
  H7992_RS09320 (H7992_09320) - 1862990..1864543 (+) 1554 WP_187047355.1 AAA family ATPase -
  H7992_RS09325 (H7992_09325) - 1864548..1865411 (+) 864 WP_187047356.1 hypothetical protein -
  H7992_RS09330 (H7992_09330) - 1865760..1866008 (+) 249 WP_187047357.1 hypothetical protein -
  H7992_RS09335 (H7992_09335) - 1866024..1866386 (+) 363 WP_187047358.1 hypothetical protein -
  H7992_RS09340 (H7992_09340) - 1866504..1867091 (+) 588 WP_222618010.1 JAB domain-containing protein -
  H7992_RS25045 (H7992_09345) - 1867003..1867545 (-) 543 Protein_1811 tyrosine-type recombinase/integrase -
  H7992_RS24500 - 1867487..1867687 (-) 201 WP_222618011.1 hypothetical protein -
  H7992_RS09350 (H7992_09350) - 1867680..1868915 (-) 1236 WP_187047359.1 site-specific integrase -
  H7992_RS09355 (H7992_09355) - 1868944..1869762 (+) 819 WP_187047843.1 reverse transcriptase domain-containing protein -
  H7992_RS09360 (H7992_09360) - 1870352..1870591 (-) 240 WP_187047360.1 hypothetical protein -
  H7992_RS09365 (H7992_09365) - 1870855..1871916 (-) 1062 WP_187047361.1 hypothetical protein -
  H7992_RS09370 (H7992_09370) istA 1872076..1873530 (+) 1455 WP_187046863.1 IS21 family transposase -
  H7992_RS09375 (H7992_09375) istB 1873527..1874252 (+) 726 WP_255428599.1 IS21-like element helper ATPase IstB -
  H7992_RS09380 (H7992_09380) - 1874516..1875811 (+) 1296 WP_187047362.1 helix-turn-helix transcriptional regulator -
  H7992_RS24665 - 1875811..1875939 (+) 129 WP_255428632.1 hypothetical protein -
  H7992_RS09385 (H7992_09385) - 1876766..1877122 (+) 357 WP_187047363.1 ion channel -
  H7992_RS09390 (H7992_09390) - 1877385..1877573 (+) 189 WP_187047364.1 hypothetical protein -
  H7992_RS09395 (H7992_09395) tnpB 1877570..1877923 (+) 354 WP_187047365.1 IS66 family insertion sequence element accessory protein TnpB -
  H7992_RS09400 (H7992_09400) - 1878110..1878427 (+) 318 WP_187047366.1 hypothetical protein -
  H7992_RS09405 (H7992_09405) - 1878424..1878639 (+) 216 WP_187047367.1 DUF2599 domain-containing protein -
  H7992_RS09410 (H7992_09410) - 1878695..1879588 (-) 894 Protein_1826 IS3 family transposase -
  H7992_RS25050 - 1879603..1879767 (-) 165 WP_370570019.1 hypothetical protein -
  H7992_RS25055 - 1879777..1879851 (-) 75 Protein_1828 hypothetical protein -
  H7992_RS09415 (H7992_09415) - 1879986..1880174 (-) 189 WP_187047368.1 hypothetical protein -
  H7992_RS09420 (H7992_09420) istB 1880171..1880926 (-) 756 WP_187047369.1 IS21-like element helper ATPase IstB -
  H7992_RS24670 - 1880923..1881282 (-) 360 WP_255428633.1 hypothetical protein -
  H7992_RS09425 (H7992_09425) istA 1881287..1882459 (-) 1173 WP_255428634.1 IS21 family transposase -
  H7992_RS09430 (H7992_09430) - 1882629..1882811 (-) 183 WP_187047370.1 transposase -
  H7992_RS09435 (H7992_09435) - 1882967..1884118 (+) 1152 WP_187047371.1 S8 family peptidase -
  H7992_RS09440 (H7992_09440) - 1884249..1884863 (+) 615 WP_187047372.1 sigma-70 family RNA polymerase sigma factor -
  H7992_RS09445 (H7992_09445) - 1884891..1885052 (+) 162 WP_187047373.1 YvrJ family protein -
  H7992_RS09450 (H7992_09450) - 1885059..1885301 (+) 243 WP_187047374.1 helix-turn-helix domain-containing protein -
  H7992_RS09460 (H7992_09460) - 1885622..1885837 (+) 216 WP_187047375.1 glutaredoxin family protein -
  H7992_RS09465 (H7992_09465) - 1886415..1887541 (+) 1127 WP_187047376.1 IS3 family transposase -
  H7992_RS25060 - 1888049..1888351 (+) 303 WP_370569985.1 hypothetical protein -
  H7992_RS25065 - 1888415..1888999 (+) 585 WP_370569986.1 IS3 family transposase -
  H7992_RS09475 (H7992_09475) - 1889028..1889300 (-) 273 WP_187047377.1 hypothetical protein -
  H7992_RS24675 - 1889567..1889836 (+) 270 Protein_1843 DDE-type integrase/transposase/recombinase -
  H7992_RS09480 (H7992_09480) - 1890009..1891103 (+) 1095 WP_187047378.1 transposase -
  H7992_RS09485 (H7992_09485) - 1891119..1891682 (+) 564 WP_187047379.1 transposase -
  H7992_RS09490 (H7992_09490) - 1891696..1891977 (-) 282 WP_187047380.1 PrgI family protein -
  H7992_RS09495 (H7992_09495) - 1892123..1892431 (-) 309 WP_187047381.1 hypothetical protein -
  H7992_RS09500 (H7992_09500) - 1893044..1893796 (+) 753 WP_187047382.1 hypothetical protein -
  H7992_RS09505 (H7992_09505) - 1893882..1894274 (+) 393 WP_187047383.1 hypothetical protein -
  H7992_RS09510 (H7992_09510) - 1894346..1896388 (+) 2043 WP_187047384.1 hypothetical protein -

Sequence


Protein


Download         Length: 158 a.a.        Molecular weight: 17581.54 Da        Isoelectric Point: 8.8645

>NTDB_id=475335 H7992_RS09300 WP_187047842.1 1860097..1860573(+) (ssbA) [Sporosarcina sp. resist]
MMNNVSLVGRLTKKPELKYTQNGVAVCNFMLAVKRPFKNANGENEADFIMVQVWRKPAENAANFLKKGSQAAVNGRISTR
HYENDKGDRIYVTEVVADFVQFLDPKPQGQGNQQRQGQESSQKQPNPYASNSNTQNQNGNQFETSGGPVVVSDDDLPF

Nucleotide


Download         Length: 477 bp        

>NTDB_id=475335 H7992_RS09300 WP_187047842.1 1860097..1860573(+) (ssbA) [Sporosarcina sp. resist]
ATTATGAATAACGTTAGTTTGGTAGGTCGTCTGACGAAAAAGCCAGAACTAAAATACACACAAAACGGTGTTGCTGTTTG
CAACTTTATGCTTGCAGTGAAGCGTCCATTTAAAAATGCTAATGGTGAAAATGAAGCTGACTTCATCATGGTTCAAGTTT
GGAGGAAACCTGCCGAAAATGCGGCTAACTTCCTTAAAAAAGGCAGTCAAGCTGCGGTGAATGGTCGTATTAGCACACGG
CATTATGAAAACGACAAGGGTGACCGTATATACGTCACAGAGGTTGTCGCTGACTTTGTACAATTTCTCGACCCGAAACC
TCAAGGTCAAGGCAACCAACAACGGCAAGGACAGGAGAGCTCCCAGAAACAGCCTAATCCTTACGCTAGTAACAGTAACA
CTCAAAATCAAAATGGTAATCAATTCGAAACGAGTGGAGGTCCTGTTGTGGTAAGCGATGATGACCTGCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7G8XD32

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

51.163

100

0.557

  ssb Latilactobacillus sakei subsp. sakei 23K

45.882

100

0.494

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.333

68.354

0.399