Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | H7F27_RS05175 | Genome accession | NZ_CP060193 |
| Coordinates | 1049618..1049758 (+) | Length | 46 a.a. |
| NCBI ID | WP_024122683.1 | Uniprot ID | A0A9Q4HP57 |
| Organism | Bacillus sp. PAMC26543 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 1044618..1054758
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H7F27_RS05150 (H7F27_05150) | - | 1044955..1045314 (+) | 360 | WP_395958026.1 | YueI family protein | - |
| H7F27_RS05155 (H7F27_05155) | - | 1045411..1045963 (+) | 553 | Protein_1019 | cysteine hydrolase family protein | - |
| H7F27_RS05160 (H7F27_05160) | - | 1045979..1047448 (+) | 1470 | WP_024122686.1 | nicotinate phosphoribosyltransferase | - |
| H7F27_RS05165 (H7F27_05165) | - | 1047584..1048813 (+) | 1230 | WP_024122685.1 | EAL and HDOD domain-containing protein | - |
| H7F27_RS05170 (H7F27_05170) | - | 1048789..1049157 (-) | 369 | WP_024122684.1 | hypothetical protein | - |
| H7F27_RS05175 (H7F27_05175) | degQ | 1049618..1049758 (+) | 141 | WP_024122683.1 | degradation enzyme regulation protein DegQ | Regulator |
| H7F27_RS05180 (H7F27_05180) | - | 1049943..1050812 (+) | 870 | WP_101864136.1 | polyprenyl synthetase family protein | - |
| H7F27_RS05185 (H7F27_05185) | comX | 1050809..1051030 (+) | 222 | WP_059292642.1 | competence pheromone ComX | - |
| H7F27_RS05190 (H7F27_05190) | comP | 1051046..1053352 (+) | 2307 | WP_185848673.1 | histidine kinase | Regulator |
| H7F27_RS05195 (H7F27_05195) | comA | 1053433..1054077 (+) | 645 | WP_101864137.1 | two-component system response regulator ComA | Regulator |
| H7F27_RS05200 (H7F27_05200) | - | 1054095..1054475 (+) | 381 | WP_024122679.1 | hotdog fold thioesterase | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5533.44 Da Isoelectric Point: 6.2559
>NTDB_id=474484 H7F27_RS05175 WP_024122683.1 1049618..1049758(+) (degQ) [Bacillus sp. PAMC26543]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=474484 H7F27_RS05175 WP_024122683.1 1049618..1049758(+) (degQ) [Bacillus sp. PAMC26543]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATATGCAATGAAAATTTCGTAA
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATATGCAATGAAAATTTCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
97.826 |
100 |
0.978 |