Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   H5405_RS04675 Genome accession   NZ_CP060085
Coordinates   924448..924588 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain HAB-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 919448..929588
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H5405_RS04650 (H5405_04650) - 919751..920149 (+) 399 WP_007613438.1 YueI family protein -
  H5405_RS04655 (H5405_04655) - 920246..920797 (+) 552 WP_003152033.1 cysteine hydrolase family protein -
  H5405_RS04660 (H5405_04660) - 920815..922281 (+) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  H5405_RS04665 (H5405_04665) - 922411..923634 (+) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  H5405_RS04670 (H5405_04670) - 923641..923982 (-) 342 WP_007613435.1 hypothetical protein -
  H5405_RS04675 (H5405_04675) degQ 924448..924588 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  H5405_RS04680 (H5405_04680) - 924740..925651 (+) 912 WP_007613433.1 polyprenyl synthetase family protein -
  H5405_RS04685 (H5405_04685) comX 925651..925815 (+) 165 WP_007613432.1 competence pheromone ComX -
  H5405_RS04690 (H5405_04690) comP 925827..928115 (+) 2289 WP_007613431.1 histidine kinase Regulator
  H5405_RS04695 (H5405_04695) comA 928196..928840 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  H5405_RS04700 (H5405_04700) - 928862..929245 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=473777 H5405_RS04675 WP_003152043.1 924448..924588(+) (degQ) [Bacillus velezensis strain HAB-2]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=473777 H5405_RS04675 WP_003152043.1 924448..924588(+) (degQ) [Bacillus velezensis strain HAB-2]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891