Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   H4K32_RS15765 Genome accession   NZ_CP059855
Coordinates   3037127..3037300 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Pm9     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 3032127..3042300
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H4K32_RS15715 comGD 3032247..3032684 (+) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  H4K32_RS15720 comGE 3032668..3032982 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  H4K32_RS15725 comGF 3032996..3033391 (+) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  H4K32_RS15730 comGG 3033392..3033769 (+) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  H4K32_RS15735 - 3033826..3034005 (+) 180 WP_003153093.1 YqzE family protein -
  H4K32_RS15740 - 3034045..3034374 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  H4K32_RS15745 tapA 3034634..3035305 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  H4K32_RS15750 sipW 3035277..3035861 (+) 585 WP_012117977.1 signal peptidase I SipW -
  H4K32_RS15755 tasA 3035925..3036710 (+) 786 WP_182274801.1 biofilm matrix protein TasA -
  H4K32_RS15760 sinR 3036758..3037093 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  H4K32_RS15765 sinI 3037127..3037300 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  H4K32_RS15770 - 3037477..3038271 (-) 795 WP_182274802.1 YqhG family protein -
  H4K32_RS15775 - 3038289..3039959 (-) 1671 WP_058906183.1 DEAD/DEAH box helicase -
  H4K32_RS15780 gcvT 3040382..3041482 (+) 1101 WP_024085597.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=472322 H4K32_RS15765 WP_003153105.1 3037127..3037300(-) (sinI) [Bacillus velezensis strain Pm9]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=472322 H4K32_RS15765 WP_003153105.1 3037127..3037300(-) (sinI) [Bacillus velezensis strain Pm9]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702