Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   H4K32_RS15720 Genome accession   NZ_CP059855
Coordinates   3032668..3032982 (+) Length   104 a.a.
NCBI ID   WP_015388003.1    Uniprot ID   -
Organism   Bacillus velezensis strain Pm9     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 3027668..3037982
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H4K32_RS15695 - 3028708..3029658 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  H4K32_RS15700 comGA 3029850..3030920 (+) 1071 WP_182274800.1 competence type IV pilus ATPase ComGA Machinery gene
  H4K32_RS15705 comGB 3030907..3031944 (+) 1038 WP_063174751.1 competence type IV pilus assembly protein ComGB Machinery gene
  H4K32_RS15710 comGC 3031991..3032257 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  H4K32_RS15715 comGD 3032247..3032684 (+) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  H4K32_RS15720 comGE 3032668..3032982 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  H4K32_RS15725 comGF 3032996..3033391 (+) 396 WP_015388004.1 competence type IV pilus minor pilin ComGF -
  H4K32_RS15730 comGG 3033392..3033769 (+) 378 WP_015388005.1 competence type IV pilus minor pilin ComGG Machinery gene
  H4K32_RS15735 - 3033826..3034005 (+) 180 WP_003153093.1 YqzE family protein -
  H4K32_RS15740 - 3034045..3034374 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  H4K32_RS15745 tapA 3034634..3035305 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  H4K32_RS15750 sipW 3035277..3035861 (+) 585 WP_012117977.1 signal peptidase I SipW -
  H4K32_RS15755 tasA 3035925..3036710 (+) 786 WP_182274801.1 biofilm matrix protein TasA -
  H4K32_RS15760 sinR 3036758..3037093 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  H4K32_RS15765 sinI 3037127..3037300 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 104 a.a.        Molecular weight: 11844.85 Da        Isoelectric Point: 6.9470

>NTDB_id=472319 H4K32_RS15720 WP_015388003.1 3032668..3032982(+) (comGE) [Bacillus velezensis strain Pm9]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTGMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=472319 H4K32_RS15720 WP_015388003.1 3032668..3032982(+) (comGE) [Bacillus velezensis strain Pm9]
ATGCTAAACGGAAATAAAGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGGCATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481