Detailed information    

insolico Bioinformatically predicted

Overview


Name   comP   Type   Machinery gene
Locus tag   H3L92_RS07915 Genome accession   NZ_CP059570
Coordinates   1662698..1663162 (-) Length   154 a.a.
NCBI ID   WP_085366237.1    Uniprot ID   A0A1X3D6X8
Organism   Neisseria dentiae strain DSM 19151     
Function   DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1661917..1705644 1662698..1663162 within 0


Gene organization within MGE regions


Location: 1661917..1705644
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H3L92_RS07910 (H3L92_07910) - 1661958..1662275 (+) 318 WP_085366238.1 DUF2322 family protein -
  H3L92_RS07915 (H3L92_07915) comP 1662698..1663162 (-) 465 WP_085366237.1 type IV pilin protein Machinery gene
  H3L92_RS07920 (H3L92_07920) - 1663259..1663723 (-) 465 WP_085366236.1 type IV pilin protein -
  H3L92_RS07925 (H3L92_07925) - 1664472..1665644 (+) 1173 WP_085366235.1 efflux RND transporter periplasmic adaptor subunit -
  H3L92_RS07930 (H3L92_07930) - 1665657..1667594 (+) 1938 WP_085366234.1 MacB family efflux pump subunit -
  H3L92_RS07935 (H3L92_07935) - 1667649..1669043 (+) 1395 WP_085366233.1 TolC family protein -
  H3L92_RS07940 (H3L92_07940) - 1669523..1670431 (-) 909 WP_085366232.1 Dyp-type peroxidase -
  H3L92_RS07945 (H3L92_07945) - 1670608..1671699 (+) 1092 WP_085366231.1 metallophosphoesterase -
  H3L92_RS07950 (H3L92_07950) trpS 1671965..1672975 (-) 1011 WP_085366230.1 tryptophan--tRNA ligase -
  H3L92_RS07955 (H3L92_07955) clpB 1673275..1675845 (+) 2571 WP_085366229.1 ATP-dependent chaperone ClpB -
  H3L92_RS07960 (H3L92_07960) - 1676110..1676757 (-) 648 WP_085366228.1 deoxynucleoside kinase -
  H3L92_RS07965 (H3L92_07965) folK 1676903..1677439 (-) 537 WP_085366227.1 2-amino-4-hydroxy-6- hydroxymethyldihydropteridine diphosphokinase -
  H3L92_RS07970 (H3L92_07970) - 1677459..1677830 (-) 372 WP_085366226.1 SirB2 family protein -
  H3L92_RS07975 (H3L92_07975) der 1678284..1679741 (-) 1458 WP_085367010.1 ribosome biogenesis GTPase Der -
  H3L92_RS07980 (H3L92_07980) - 1679902..1680531 (-) 630 WP_085367009.1 tetratricopeptide repeat protein -
  H3L92_RS07985 (H3L92_07985) hisS 1680532..1681827 (-) 1296 WP_085367008.1 histidine--tRNA ligase -
  H3L92_RS07990 (H3L92_07990) - 1681866..1682264 (-) 399 WP_085367007.1 hypothetical protein -
  H3L92_RS07995 (H3L92_07995) ispG 1682319..1683590 (-) 1272 WP_085367006.1 flavodoxin-dependent (E)-4-hydroxy-3-methylbut-2-enyl-diphosphate synthase -
  H3L92_RS08000 (H3L92_08000) - 1683587..1684489 (-) 903 WP_085367005.1 helix-turn-helix domain-containing protein -
  H3L92_RS08005 (H3L92_08005) pilW 1684489..1685253 (-) 765 WP_085367004.1 type IV pilus biogenesis/stability protein PilW -
  H3L92_RS08010 (H3L92_08010) rlmN 1685250..1686350 (-) 1101 WP_085367003.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  H3L92_RS08015 (H3L92_08015) ndk 1686483..1686908 (-) 426 WP_085367002.1 nucleoside-diphosphate kinase -
  H3L92_RS08020 (H3L92_08020) zapE 1687025..1688176 (-) 1152 WP_085367001.1 cell division protein ZapE -
  H3L92_RS08025 (H3L92_08025) - 1688295..1689101 (-) 807 WP_085367000.1 DUF4198 domain-containing protein -
  H3L92_RS08030 (H3L92_08030) - 1689270..1689971 (+) 702 WP_158088180.1 CPBP family intramembrane glutamic endopeptidase -
  H3L92_RS08035 (H3L92_08035) - 1690077..1691438 (-) 1362 WP_085366998.1 PFL family protein -
  H3L92_RS08040 (H3L92_08040) - 1691451..1691723 (-) 273 WP_085366997.1 ACT domain-containing protein -
  H3L92_RS08045 (H3L92_08045) - 1691964..1693238 (-) 1275 WP_085366996.1 cell division protein ZipA C-terminal FtsZ-binding domain-containing protein -
  H3L92_RS08050 (H3L92_08050) ampD 1693318..1693866 (-) 549 WP_085366995.1 1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD -
  H3L92_RS08055 (H3L92_08055) mltG 1694004..1694999 (+) 996 WP_085367012.1 endolytic transglycosylase MltG -
  H3L92_RS08060 (H3L92_08060) tmk 1695125..1695745 (+) 621 WP_085367011.1 dTMP kinase -
  H3L92_RS08065 (H3L92_08065) - 1695826..1696725 (-) 900 WP_115336201.1 IS3 family transposase -
  H3L92_RS08070 (H3L92_08070) - 1696623..1696976 (-) 354 WP_115336199.1 helix-turn-helix domain-containing protein -
  H3L92_RS08075 (H3L92_08075) - 1697134..1697355 (+) 222 WP_085366965.1 heavy-metal-associated domain-containing protein -
  H3L92_RS08080 (H3L92_08080) - 1697381..1699543 (+) 2163 WP_085366966.1 cation-translocating P-type ATPase -
  H3L92_RS08085 (H3L92_08085) recN 1699732..1701393 (+) 1662 WP_085366967.1 DNA repair protein RecN -
  H3L92_RS08090 (H3L92_08090) - 1701705..1702061 (-) 357 WP_085366968.1 RidA family protein -
  H3L92_RS08095 (H3L92_08095) - 1702202..1702681 (+) 480 WP_085366969.1 aminoacyl-tRNA deacylase -
  H3L92_RS08100 (H3L92_08100) clpX 1703019..1704275 (-) 1257 WP_085366970.1 ATP-dependent Clp protease ATP-binding subunit ClpX -
  H3L92_RS08105 (H3L92_08105) - 1704651..1705586 (+) 936 WP_085366971.1 serine hydrolase -

Sequence


Protein


Download         Length: 154 a.a.        Molecular weight: 16906.36 Da        Isoelectric Point: 9.6544

>NTDB_id=470831 H3L92_RS07915 WP_085366237.1 1662698..1663162(-) (comP) [Neisseria dentiae strain DSM 19151]
MQNACRQGFTLLELLAAIAISAVLAVIAVPAYQKYVLDTRLNHARTVLLQNAHFMERFYQQHRSFKQTSTTWPALPHTAT
GHFCIRPQGNARGAHDGKFTLKAVAFDKNSEARIIKINESLTAVVCESSASTCADSGSFFAGGSTVDKKCRVFQ

Nucleotide


Download         Length: 465 bp        

>NTDB_id=470831 H3L92_RS07915 WP_085366237.1 1662698..1663162(-) (comP) [Neisseria dentiae strain DSM 19151]
ATGCAAAATGCCTGCCGACAAGGCTTCACATTACTTGAACTGCTTGCTGCCATAGCCATATCGGCTGTTTTGGCCGTGAT
TGCGGTTCCCGCTTATCAAAAATATGTCCTCGACACCCGTTTGAACCATGCCCGAACGGTGCTGCTGCAAAACGCCCATT
TTATGGAACGTTTTTACCAGCAGCACCGCTCGTTCAAACAGACTTCCACCACTTGGCCTGCGCTGCCGCATACGGCAACC
GGTCATTTCTGTATCCGCCCTCAAGGGAACGCCCGCGGTGCGCATGACGGCAAATTTACCCTGAAAGCCGTTGCATTCGA
TAAAAACAGCGAAGCGCGCATTATTAAGATCAACGAATCGTTAACTGCCGTGGTGTGCGAGAGCAGTGCCAGCACTTGTG
CGGACAGTGGAAGCTTTTTTGCCGGTGGGAGCACGGTGGATAAAAAGTGTAGGGTATTCCAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1X3D6X8

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comP Neisseria meningitidis 8013

50.676

96.104

0.487

  comP Neisseria gonorrhoeae MS11

50

96.104

0.481

  comP Neisseria subflava NJ9703

44.667

97.403

0.435