Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   H2N97_RS15785 Genome accession   NZ_CP059497
Coordinates   3188475..3188615 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain JSRB 08     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3183475..3193615
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H2N97_RS15760 (H2N97_15760) - 3183771..3184154 (-) 384 WP_017419422.1 hotdog fold thioesterase -
  H2N97_RS15765 (H2N97_15765) comA 3184176..3184820 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  H2N97_RS15770 (H2N97_15770) comP 3184901..3187210 (-) 2310 WP_087634938.1 histidine kinase Regulator
  H2N97_RS15775 (H2N97_15775) - 3187230..3187406 (-) 177 WP_087634937.1 competence pheromone ComX -
  H2N97_RS15780 (H2N97_15780) comQ 3187406..3188344 (-) 939 WP_271243340.1 class 1 isoprenoid biosynthesis enzyme Regulator
  H2N97_RS15785 (H2N97_15785) degQ 3188475..3188615 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  H2N97_RS15790 (H2N97_15790) - 3189080..3189421 (+) 342 WP_014418765.1 hypothetical protein -
  H2N97_RS15795 (H2N97_15795) - 3189428..3190651 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  H2N97_RS15800 (H2N97_15800) - 3190781..3192247 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  H2N97_RS15805 (H2N97_15805) - 3192265..3192816 (-) 552 WP_025853916.1 cysteine hydrolase family protein -
  H2N97_RS15810 (H2N97_15810) - 3192913..3193311 (-) 399 WP_087634936.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=470236 H2N97_RS15785 WP_003152043.1 3188475..3188615(-) (degQ) [Bacillus velezensis strain JSRB 08]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=470236 H2N97_RS15785 WP_003152043.1 3188475..3188615(-) (degQ) [Bacillus velezensis strain JSRB 08]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891