Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   JR441_RS12290 Genome accession   NZ_CP069789
Coordinates   2416532..2416705 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain BIM B-569G     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2411532..2421705
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JR441_RS12275 (JR441_12275) gcvT 2412331..2413419 (-) 1089 WP_015714248.1 glycine cleavage system aminomethyltransferase GcvT -
  JR441_RS12280 (JR441_12280) hepAA 2413861..2415534 (+) 1674 WP_198878635.1 SNF2-related protein -
  JR441_RS12285 (JR441_12285) yqhG 2415555..2416349 (+) 795 WP_003230200.1 YqhG family protein -
  JR441_RS12290 (JR441_12290) sinI 2416532..2416705 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  JR441_RS12295 (JR441_12295) sinR 2416739..2417074 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JR441_RS12300 (JR441_12300) tasA 2417167..2417952 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  JR441_RS12305 (JR441_12305) sipW 2418016..2418588 (-) 573 WP_072692741.1 signal peptidase I SipW -
  JR441_RS12310 (JR441_12310) tapA 2418572..2419333 (-) 762 WP_198878634.1 amyloid fiber anchoring/assembly protein TapA -
  JR441_RS12315 (JR441_12315) yqzG 2419605..2419931 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  JR441_RS12320 (JR441_12320) spoIITA 2419973..2420152 (-) 180 WP_072175549.1 YqzE family protein -
  JR441_RS12325 (JR441_12325) comGG 2420223..2420597 (-) 375 WP_133953114.1 ComG operon protein ComGG Machinery gene
  JR441_RS12330 (JR441_12330) comGF 2420598..2420981 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  JR441_RS12335 (JR441_12335) comGE 2421007..2421354 (-) 348 WP_080529537.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=470231 JR441_RS12290 WP_003230187.1 2416532..2416705(+) (sinI) [Bacillus subtilis strain BIM B-569G]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=470231 JR441_RS12290 WP_003230187.1 2416532..2416705(+) (sinI) [Bacillus subtilis strain BIM B-569G]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1