Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   H2N74_RS12150 Genome accession   NZ_CP059495
Coordinates   2527328..2527705 (-) Length   125 a.a.
NCBI ID   WP_053284923.1    Uniprot ID   -
Organism   Bacillus velezensis strain JSRB 166     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2522328..2532705
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H2N74_RS12110 (H2N74_12110) - 2522824..2523618 (+) 795 WP_014418368.1 YqhG family protein -
  H2N74_RS12115 (H2N74_12115) sinI 2523795..2523968 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  H2N74_RS12120 (H2N74_12120) sinR 2524002..2524337 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  H2N74_RS12125 (H2N74_12125) tasA 2524385..2525170 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  H2N74_RS12130 (H2N74_12130) sipW 2525236..2525820 (-) 585 WP_012117977.1 signal peptidase I SipW -
  H2N74_RS12135 (H2N74_12135) tapA 2525792..2526463 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  H2N74_RS12140 (H2N74_12140) - 2526722..2527051 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  H2N74_RS12145 (H2N74_12145) - 2527092..2527271 (-) 180 WP_003153093.1 YqzE family protein -
  H2N74_RS12150 (H2N74_12150) comGG 2527328..2527705 (-) 378 WP_053284923.1 competence type IV pilus minor pilin ComGG Machinery gene
  H2N74_RS12155 (H2N74_12155) comGF 2527706..2528101 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  H2N74_RS12160 (H2N74_12160) comGE 2528115..2528429 (-) 315 WP_088056452.1 competence type IV pilus minor pilin ComGE -
  H2N74_RS12165 (H2N74_12165) comGD 2528413..2528850 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  H2N74_RS12170 (H2N74_12170) comGC 2528840..2529148 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  H2N74_RS12175 (H2N74_12175) comGB 2529153..2530190 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  H2N74_RS12180 (H2N74_12180) comGA 2530177..2531247 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  H2N74_RS12185 (H2N74_12185) - 2531440..2532390 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14072.97 Da        Isoelectric Point: 9.7163

>NTDB_id=470139 H2N74_RS12150 WP_053284923.1 2527328..2527705(-) (comGG) [Bacillus velezensis strain JSRB 166]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKAQAGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREATLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=470139 H2N74_RS12150 WP_053284923.1 2527328..2527705(-) (comGG) [Bacillus velezensis strain JSRB 166]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGCCCAGGCTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTACCCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504