Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   H2N74_RS12115 Genome accession   NZ_CP059495
Coordinates   2523795..2523968 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain JSRB 166     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2518795..2528968
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H2N74_RS12100 (H2N74_12100) gcvT 2519608..2520708 (-) 1101 WP_017418134.1 glycine cleavage system aminomethyltransferase GcvT -
  H2N74_RS12105 (H2N74_12105) - 2521132..2522802 (+) 1671 WP_038461530.1 DEAD/DEAH box helicase -
  H2N74_RS12110 (H2N74_12110) - 2522824..2523618 (+) 795 WP_014418368.1 YqhG family protein -
  H2N74_RS12115 (H2N74_12115) sinI 2523795..2523968 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  H2N74_RS12120 (H2N74_12120) sinR 2524002..2524337 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  H2N74_RS12125 (H2N74_12125) tasA 2524385..2525170 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  H2N74_RS12130 (H2N74_12130) sipW 2525236..2525820 (-) 585 WP_012117977.1 signal peptidase I SipW -
  H2N74_RS12135 (H2N74_12135) tapA 2525792..2526463 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  H2N74_RS12140 (H2N74_12140) - 2526722..2527051 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  H2N74_RS12145 (H2N74_12145) - 2527092..2527271 (-) 180 WP_003153093.1 YqzE family protein -
  H2N74_RS12150 (H2N74_12150) comGG 2527328..2527705 (-) 378 WP_053284923.1 competence type IV pilus minor pilin ComGG Machinery gene
  H2N74_RS12155 (H2N74_12155) comGF 2527706..2528101 (-) 396 WP_046559876.1 competence type IV pilus minor pilin ComGF -
  H2N74_RS12160 (H2N74_12160) comGE 2528115..2528429 (-) 315 WP_088056452.1 competence type IV pilus minor pilin ComGE -
  H2N74_RS12165 (H2N74_12165) comGD 2528413..2528850 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=470137 H2N74_RS12115 WP_014418369.1 2523795..2523968(+) (sinI) [Bacillus velezensis strain JSRB 166]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=470137 H2N74_RS12115 WP_014418369.1 2523795..2523968(+) (sinI) [Bacillus velezensis strain JSRB 166]
ATGAAAAATGCAAAAACAGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719