Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HP2017_RS00195 Genome accession   NC_017374
Coordinates   35313..35426 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori 2017     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30313..40426
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HP2017_RS00170 (hp2017_0034) - 30354..32582 (+) 2229 WP_000357209.1 ATP-dependent Clp protease ATP-binding subunit -
  HP2017_RS00175 (hp2017_0035) panD 32572..32925 (+) 354 WP_000142275.1 aspartate 1-decarboxylase -
  HP2017_RS00180 (hp2017_0036) - 32928..33230 (+) 303 WP_000347926.1 YbaB/EbfC family nucleoid-associated protein -
  HP2017_RS00185 (hp2017_0037) - 33230..34234 (+) 1005 WP_000965841.1 PDZ domain-containing protein -
  HP2017_RS00190 (hp2017_0038) comB6 34242..35297 (+) 1056 WP_000679716.1 P-type conjugative transfer protein TrbL Machinery gene
  HP2017_RS00195 (hp2017_0039) comB7 35313..35426 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  HP2017_RS00200 (hp2017_0040) comB8 35423..36166 (+) 744 WP_000660538.1 virB8 family protein Machinery gene
  HP2017_RS00205 (hp2017_0041) comB9 36166..37152 (+) 987 WP_014536255.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HP2017_RS00210 (hp2017_0042) comB10 37145..38275 (+) 1131 WP_001045760.1 DNA type IV secretion system protein ComB10 Machinery gene
  HP2017_RS00215 (hp2017_0043) - 38345..39757 (+) 1413 WP_000694991.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=46976 HP2017_RS00195 WP_001217877.1 35313..35426(+) (comB7) [Helicobacter pylori 2017]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=46976 HP2017_RS00195 WP_001217877.1 35313..35426(+) (comB7) [Helicobacter pylori 2017]
ATGAGGATTTTTTTTGTTATTATGGGACTTGTGCTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAGAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment