Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   HU024_RS05105 Genome accession   NZ_CP059344
Coordinates   970325..970702 (+) Length   125 a.a.
NCBI ID   WP_032874019.1    Uniprot ID   -
Organism   Bacillus velezensis strain K01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 965325..975702
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HU024_RS05070 (HU024_05070) - 965636..966586 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  HU024_RS05075 (HU024_05075) comGA 966783..967853 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HU024_RS05080 (HU024_05080) comGB 967840..968877 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  HU024_RS05085 (HU024_05085) comGC 968924..969190 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  HU024_RS05090 (HU024_05090) comGD 969180..969617 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  HU024_RS05095 (HU024_05095) comGE 969601..969915 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  HU024_RS05100 (HU024_05100) comGF 969860..970324 (+) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  HU024_RS05105 (HU024_05105) comGG 970325..970702 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  HU024_RS05110 (HU024_05110) - 970759..970938 (+) 180 WP_022552966.1 YqzE family protein -
  HU024_RS05115 (HU024_05115) - 970979..971308 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  HU024_RS05120 (HU024_05120) tapA 971567..972238 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  HU024_RS05125 (HU024_05125) sipW 972210..972794 (+) 585 WP_032874025.1 signal peptidase I SipW -
  HU024_RS05130 (HU024_05130) tasA 972859..973644 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  HU024_RS05135 (HU024_05135) sinR 973692..974027 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HU024_RS05140 (HU024_05140) sinI 974061..974234 (-) 174 WP_032874029.1 anti-repressor SinI Regulator
  HU024_RS05145 (HU024_05145) - 974411..975205 (-) 795 WP_007612541.1 YqhG family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14077.01 Da        Isoelectric Point: 10.2236

>NTDB_id=468860 HU024_RS05105 WP_032874019.1 970325..970702(+) (comGG) [Bacillus velezensis strain K01]
MSKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMAQGKKARTGTQRFPYGTVS
FHISGSDRRETVQVTIQTETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=468860 HU024_RS05105 WP_032874019.1 970325..970702(+) (comGG) [Bacillus velezensis strain K01]
ATGTCCAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGGCACAGGGAAAAAAGGCCCGAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCTCCGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGACGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterProScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

49.194

99.2

0.488