Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGC   Type   Machinery gene
Locus tag   HU024_RS05085 Genome accession   NZ_CP059344
Coordinates   968924..969190 (+) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain K01     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 963924..974190
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HU024_RS05065 (HU024_05065) - 964189..965490 (-) 1302 WP_032874010.1 hemolysin family protein -
  HU024_RS05070 (HU024_05070) - 965636..966586 (+) 951 WP_032874012.1 magnesium transporter CorA family protein -
  HU024_RS05075 (HU024_05075) comGA 966783..967853 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HU024_RS05080 (HU024_05080) comGB 967840..968877 (+) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  HU024_RS05085 (HU024_05085) comGC 968924..969190 (+) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  HU024_RS05090 (HU024_05090) comGD 969180..969617 (+) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  HU024_RS05095 (HU024_05095) comGE 969601..969915 (+) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  HU024_RS05100 (HU024_05100) comGF 969860..970324 (+) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF -
  HU024_RS05105 (HU024_05105) comGG 970325..970702 (+) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  HU024_RS05110 (HU024_05110) - 970759..970938 (+) 180 WP_022552966.1 YqzE family protein -
  HU024_RS05115 (HU024_05115) - 970979..971308 (-) 330 WP_032874021.1 DUF3889 domain-containing protein -
  HU024_RS05120 (HU024_05120) tapA 971567..972238 (+) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  HU024_RS05125 (HU024_05125) sipW 972210..972794 (+) 585 WP_032874025.1 signal peptidase I SipW -
  HU024_RS05130 (HU024_05130) tasA 972859..973644 (+) 786 WP_032874027.1 biofilm matrix protein TasA -
  HU024_RS05135 (HU024_05135) sinR 973692..974027 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator

Sequence

Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=468857 HU024_RS05085 WP_042635730.1 968924..969190(+) (comGC) [Bacillus velezensis strain K01]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=468857 HU024_RS05085 WP_042635730.1 968924..969190(+) (comGC) [Bacillus velezensis strain K01]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602