Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   HZT45_RS14535 Genome accession   NZ_CP059318
Coordinates   2999681..2999821 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain BIOMA BV10     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2994681..3004821
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HZT45_RS14510 (HZT45_14510) - 2994977..2995360 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  HZT45_RS14515 (HZT45_14515) comA 2995382..2996026 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  HZT45_RS14520 (HZT45_14520) comP 2996107..2998416 (-) 2310 WP_020954299.1 histidine kinase Regulator
  HZT45_RS14525 (HZT45_14525) - 2998436..2998612 (-) 177 WP_007408675.1 competence pheromone ComX -
  HZT45_RS14530 (HZT45_14530) comQ 2998612..2999496 (-) 885 WP_032865221.1 class 1 isoprenoid biosynthesis enzyme Regulator
  HZT45_RS14535 (HZT45_14535) degQ 2999681..2999821 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  HZT45_RS14540 (HZT45_14540) - 3000286..3000627 (+) 342 WP_012118316.1 hypothetical protein -
  HZT45_RS14545 (HZT45_14545) - 3000634..3001857 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  HZT45_RS14550 (HZT45_14550) - 3001987..3003453 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  HZT45_RS14555 (HZT45_14555) - 3003471..3004022 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  HZT45_RS14560 (HZT45_14560) - 3004119..3004517 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=468547 HZT45_RS14535 WP_003152043.1 2999681..2999821(-) (degQ) [Bacillus velezensis strain BIOMA BV10]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=468547 HZT45_RS14535 WP_003152043.1 2999681..2999821(-) (degQ) [Bacillus velezensis strain BIOMA BV10]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891