Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGC   Type   Machinery gene
Locus tag   HZT45_RS11670 Genome accession   NZ_CP059318
Coordinates   2451096..2451362 (-) Length   88 a.a.
NCBI ID   WP_042635730.1    Uniprot ID   -
Organism   Bacillus velezensis strain BIOMA BV10     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2446096..2456362
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HZT45_RS11620 (HZT45_11620) sinR 2446259..2446594 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  HZT45_RS11625 (HZT45_11625) tasA 2446642..2447427 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  HZT45_RS11630 (HZT45_11630) sipW 2447492..2448076 (-) 585 WP_012117977.1 signal peptidase I SipW -
  HZT45_RS11635 (HZT45_11635) tapA 2448048..2448719 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  HZT45_RS11640 (HZT45_11640) - 2448978..2449307 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  HZT45_RS11645 (HZT45_11645) - 2449348..2449527 (-) 180 WP_003153093.1 YqzE family protein -
  HZT45_RS11650 (HZT45_11650) comGG 2449584..2449961 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  HZT45_RS11655 (HZT45_11655) comGF 2449962..2450462 (-) 501 WP_257726452.1 competence type IV pilus minor pilin ComGF -
  HZT45_RS11660 (HZT45_11660) comGE 2450371..2450685 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  HZT45_RS11665 (HZT45_11665) comGD 2450669..2451106 (-) 438 WP_052827646.1 competence type IV pilus minor pilin ComGD Machinery gene
  HZT45_RS11670 (HZT45_11670) comGC 2451096..2451362 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  HZT45_RS11675 (HZT45_11675) comGB 2451409..2452446 (-) 1038 WP_012117984.1 competence type IV pilus assembly protein ComGB Machinery gene
  HZT45_RS11680 (HZT45_11680) comGA 2452433..2453503 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  HZT45_RS11685 (HZT45_11685) - 2453700..2454650 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  HZT45_RS11690 (HZT45_11690) - 2454796..2456097 (+) 1302 WP_021494315.1 hemolysin family protein -

Sequence


Protein


Download         Length: 88 a.a.        Molecular weight: 9721.32 Da        Isoelectric Point: 6.2027

>NTDB_id=468529 HZT45_RS11670 WP_042635730.1 2451096..2451362(-) (comGC) [Bacillus velezensis strain BIOMA BV10]
MLIVLFIVSILLLITIPNVTKHNQSIQHKGCEGLQNMVKAQVTAYEIDHEGKMPDMNDLQSEGYIKKNTACPNGKQILIS
GGEVTVEQ

Nucleotide


Download         Length: 267 bp        

>NTDB_id=468529 HZT45_RS11670 WP_042635730.1 2451096..2451362(-) (comGC) [Bacillus velezensis strain BIOMA BV10]
ATGCTGATCGTTTTATTTATCGTTTCCATTCTGCTTTTAATCACCATTCCTAACGTTACAAAACATAATCAAAGCATTCA
GCATAAAGGCTGTGAAGGACTGCAGAATATGGTGAAAGCCCAAGTGACGGCGTACGAAATCGATCATGAAGGTAAAATGC
CGGATATGAACGATTTACAATCAGAGGGGTATATCAAAAAGAATACAGCCTGCCCGAATGGTAAACAGATCTTAATTAGT
GGCGGAGAAGTTACAGTTGAACAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGC Bacillus subtilis subsp. subtilis str. 168

74.648

80.682

0.602