Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HMPREF4655_RS07555 Genome accession   NC_017360
Coordinates   1541119..1541232 (-) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   A0AAE7DTV1
Organism   Helicobacter pylori 35A     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1536119..1546232
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HMPREF4655_RS07535 (HMPREF4655_21539) - 1536806..1538218 (-) 1413 WP_000694826.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HMPREF4655_RS07540 (HMPREF4655_21540) comB10 1538288..1539424 (-) 1137 WP_001045733.1 DNA type IV secretion system protein ComB10 Machinery gene
  HMPREF4655_RS07545 (HMPREF4655_21541) comB9 1539417..1540379 (-) 963 WP_014534693.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HMPREF4655_RS07550 (HMPREF4655_21542) comB8 1540379..1541122 (-) 744 WP_000660529.1 virB8 family protein Machinery gene
  HMPREF4655_RS07555 comB7 1541119..1541232 (-) 114 WP_001217868.1 hypothetical protein Machinery gene
  HMPREF4655_RS07560 (HMPREF4655_21543) comB6 1541248..1542303 (-) 1056 WP_000786700.1 P-type conjugative transfer protein TrbL Machinery gene
  HMPREF4655_RS07565 (HMPREF4655_21544) - 1542311..1543306 (-) 996 WP_000468806.1 PDZ domain-containing protein -
  HMPREF4655_RS07570 (HMPREF4655_21545) - 1543306..1543599 (-) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  HMPREF4655_RS07575 (HMPREF4655_21546) panD 1543610..1543960 (-) 351 WP_000142214.1 aspartate 1-decarboxylase -
  HMPREF4655_RS07580 (HMPREF4655_21547) - 1543950..1546172 (-) 2223 WP_001051538.1 ATP-dependent Clp protease ATP-binding subunit -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=46801 HMPREF4655_RS07555 WP_001217868.1 1541119..1541232(-) (comB7) [Helicobacter pylori 35A]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=46801 HMPREF4655_RS07555 WP_001217868.1 1541119..1541232(-) (comB7) [Helicobacter pylori 35A]
ATGAGAATTTTTTTTGTTATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTGAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919

Multiple sequence alignment