Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   HZ310_RS03915 Genome accession   NZ_CP058951
Coordinates   786082..786222 (+) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain UAMX     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 781082..791222
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HZ310_RS03890 (HZ310_03890) - 781319..781726 (+) 408 WP_144461864.1 YueI family protein -
  HZ310_RS03895 (HZ310_03895) - 781787..782338 (+) 552 WP_144461867.1 cysteine hydrolase family protein -
  HZ310_RS03900 (HZ310_03900) - 782356..783825 (+) 1470 WP_180310168.1 nicotinate phosphoribosyltransferase -
  HZ310_RS03905 (HZ310_03905) - 783965..785191 (+) 1227 WP_012011110.1 EAL and HDOD domain-containing protein -
  HZ310_RS03910 (HZ310_03910) - 785223..785576 (-) 354 WP_034620108.1 hypothetical protein -
  HZ310_RS03915 (HZ310_03915) degQ 786082..786222 (+) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  HZ310_RS03920 (HZ310_03920) - 786374..787288 (+) 915 WP_180310169.1 polyprenyl synthetase family protein -
  HZ310_RS03925 (HZ310_03925) comX 787285..787455 (+) 171 WP_098677614.1 competence pheromone ComX -
  HZ310_RS03930 (HZ310_03930) comP 787509..789821 (+) 2313 WP_180310170.1 ATP-binding protein Regulator
  HZ310_RS03935 (HZ310_03935) comA 789902..790543 (+) 642 WP_058013793.1 response regulator transcription factor Regulator
  HZ310_RS03940 (HZ310_03940) - 790567..790956 (+) 390 WP_003213775.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=466074 HZ310_RS03915 WP_003213123.1 786082..786222(+) (degQ) [Bacillus pumilus strain UAMX]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=466074 HZ310_RS03915 WP_003213123.1 786082..786222(+) (degQ) [Bacillus pumilus strain UAMX]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAGTACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696