Detailed information
Overview
| Name | pilR | Type | Regulator |
| Locus tag | HYE74_RS17395 | Genome accession | NZ_CP058594 |
| Coordinates | 3120610..3120726 (+) | Length | 38 a.a. |
| NCBI ID | WP_218832528.1 | Uniprot ID | - |
| Organism | Heyndrickxia coagulans strain ASRS217 | ||
| Function | regulation of type IV pilus assembly (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3118146..3132372 | 3120610..3120726 | within | 0 |
Gene organization within MGE regions
Location: 3118146..3132372
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HYE74_RS14805 | - | 3118146..3118652 (-) | 507 | WP_013860569.1 | S4 domain-containing protein | - |
| HYE74_RS14810 | - | 3118837..3119373 (-) | 537 | WP_017550765.1 | isochorismatase family cysteine hydrolase | - |
| HYE74_RS14815 | - | 3119388..3119591 (-) | 204 | WP_179234738.1 | hypothetical protein | - |
| HYE74_RS14820 | - | 3119847..3120071 (+) | 225 | WP_013860568.1 | hypothetical protein | - |
| HYE74_RS14825 | - | 3120200..3120619 (+) | 420 | WP_051039153.1 | HTH domain-containing protein | - |
| HYE74_RS17395 | pilR | 3120610..3120726 (+) | 117 | WP_218832528.1 | sigma 54-interacting transcriptional regulator | Regulator |
| HYE74_RS14830 | - | 3120914..3122224 (-) | 1311 | WP_013858128.1 | transposase family protein | - |
| HYE74_RS14835 | - | 3122435..3123931 (+) | 1497 | WP_081092978.1 | sigma 54-interacting transcriptional regulator | - |
| HYE74_RS14840 | - | 3123898..3124542 (+) | 645 | WP_218832493.1 | PRD domain-containing protein | - |
| HYE74_RS14845 | - | 3124716..3125156 (+) | 441 | WP_014096937.1 | PTS sugar transporter subunit IIA | - |
| HYE74_RS14850 | - | 3125168..3125659 (+) | 492 | WP_014096938.1 | PTS sugar transporter subunit IIB | - |
| HYE74_RS14855 | - | 3125672..3126472 (+) | 801 | WP_014096939.1 | PTS sugar transporter subunit IIC | - |
| HYE74_RS14860 | - | 3126469..3127290 (+) | 822 | WP_014096940.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| HYE74_RS14865 | - | 3127313..3127990 (+) | 678 | WP_014096941.1 | hypothetical protein | - |
| HYE74_RS14870 | - | 3128175..3128627 (+) | 453 | WP_237682108.1 | transposase family protein | - |
| HYE74_RS14875 | - | 3128703..3130016 (+) | 1314 | WP_017550355.1 | IS1380-like element ISBco1 family transposase | - |
| HYE74_RS14880 | - | 3130424..3131446 (-) | 1023 | WP_061564844.1 | hypothetical protein | - |
| HYE74_RS14885 | - | 3131873..3132372 (-) | 500 | Protein_2948 | LURP-one-related/scramblase family protein | - |
Sequence
Protein
Download Length: 38 a.a. Molecular weight: 4082.70 Da Isoelectric Point: 9.0639
>NTDB_id=464493 HYE74_RS17395 WP_218832528.1 3120610..3120726(+) (pilR) [Heyndrickxia coagulans strain ASRS217]
MVLNCADYADNAELLSSVLFGYKKGAFTGATRKKTGQL
MVLNCADYADNAELLSSVLFGYKKGAFTGATRKKTGQL
Nucleotide
Download Length: 117 bp
>NTDB_id=464493 HYE74_RS17395 WP_218832528.1 3120610..3120726(+) (pilR) [Heyndrickxia coagulans strain ASRS217]
ATTGTTTTAAACTGTGCAGACTACGCAGACAATGCAGAATTATTATCTTCTGTTCTGTTTGGTTATAAAAAGGGTGCTTT
TACGGGGGCAACCCGGAAAAAGACGGGCCAGCTCTGA
ATTGTTTTAAACTGTGCAGACTACGCAGACAATGCAGAATTATTATCTTCTGTTCTGTTTGGTTATAAAAAGGGTGCTTT
TACGGGGGCAACCCGGAAAAAGACGGGCCAGCTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilR | Acinetobacter baumannii strain A118 |
52.778 |
94.737 |
0.5 |
| pilR | Pseudomonas aeruginosa PAK |
50 |
89.474 |
0.447 |
| luxO | Vibrio cholerae strain A1552 |
47.222 |
94.737 |
0.447 |