Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HWU09_RS07610 Genome accession   NZ_CP058287
Coordinates   1604776..1604889 (-) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   A0AAE7DTV1
Organism   Helicobacter pylori strain AL04     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1599776..1609889
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWU09_RS07590 - 1600466..1601878 (-) 1413 WP_237003406.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HWU09_RS07595 comB10 1601945..1603081 (-) 1137 WP_237003407.1 DNA type IV secretion system protein ComB10 Machinery gene
  HWU09_RS07600 comB9 1603074..1604036 (-) 963 WP_237003408.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HWU09_RS07605 comB8 1604036..1604779 (-) 744 WP_237003409.1 type IV secretion system protein Machinery gene
  HWU09_RS07610 comB7 1604776..1604889 (-) 114 WP_001217868.1 hypothetical protein Machinery gene
  HWU09_RS07615 comB6 1604905..1605960 (-) 1056 WP_237003960.1 P-type conjugative transfer protein TrbL Machinery gene
  HWU09_RS07620 - 1605968..1606963 (-) 996 WP_237003961.1 PDZ domain-containing protein -
  HWU09_RS07625 - 1606963..1607256 (-) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HWU09_RS07630 panD 1607267..1607617 (-) 351 WP_237003410.1 aspartate 1-decarboxylase -
  HWU09_RS07635 - 1607607..1609826 (-) 2220 WP_237003411.1 AAA family ATPase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=463477 HWU09_RS07610 WP_001217868.1 1604776..1604889(-) (comB7) [Helicobacter pylori strain AL04]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=463477 HWU09_RS07610 WP_001217868.1 1604776..1604889(-) (comB7) [Helicobacter pylori strain AL04]
ATGAGAATTTTTTTTGTCATTATGGGAATCATGTTATTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919